KEGG   Thermobaculum terrenum: Tter_0915Help
Entry
Tter_0915         CDS       T01134                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttr  Thermobaculum terrenum
Pathway
ttr00010  Glycolysis / Gluconeogenesis
ttr00051  Fructose and mannose metabolism
ttr00562  Inositol phosphate metabolism
ttr01100  Metabolic pathways
ttr01110  Biosynthesis of secondary metabolites
ttr01120  Microbial metabolism in diverse environments
ttr01130  Biosynthesis of antibiotics
ttr01200  Carbon metabolism
ttr01230  Biosynthesis of amino acids
Module
ttr_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tter_0915
   00051 Fructose and mannose metabolism
    Tter_0915
   00562 Inositol phosphate metabolism
    Tter_0915
Enzymes [BR:ttr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tter_0915
Exosome [BR:ttr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tter_0915
  Exosomal proteins of bladder cancer cells
   Tter_0915
  Exosomal proteins of melanoma cells
   Tter_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACZ41832
UniProt: D1CFX6
Position
1:974491..975243
Genome map
AA seq 250 aa AA seqDB search
MRKPLVAGNWKMHTDSSQAQDLASSIVSRVSSVTDVEVVLCPPFVWLERVAKLVEETGIL
VGAQDTFWEDWGAYTGEISPLQLSEMCSYVIVGHSERRHIIGETDEIVARKARAVARAGM
VPILAVGELEQEYKEGISKEIVSNQLSAVLADGWDHEIVIAYEPVWAIGTGLAASAQYAQ
DMAAFIREQLSSYGLNQERVRILYGGSVNRGNFKEFIEQKDIDGALVGGASLKAEEFAEL
VMMASPAMVD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctctagttgcgggtaattggaaaatgcacactgactcctctcaagctcag
gatttagcgtcatctatcgtatcgagagtttcttccgtgacggatgttgaggttgttctt
tgcccaccgtttgtttggcttgagagagtagcaaagctagttgaggagaccggcatcctc
gtcggagctcaagatacattttgggaggactggggagcatacaccggggagatatctcct
ctgcagctcagtgagatgtgcagttacgtcatagttggtcattccgaaagacggcatatt
atcggagaaactgatgaaatagtagctaggaaagctagggctgtggccagagcagggatg
gtacctatactagcggttggggagctggagcaggagtacaaagagggaatctccaaggaa
atcgttagcaatcagctctctgctgttcttgccgatggttgggatcatgaaatagtgatc
gcgtatgaacctgtttgggcgataggaacaggactggctgcttcagctcaatatgcccag
gacatggcagcctttataagggaacaacttagttcatatggcctcaatcaagagagagtt
agaatactctatggtgggagcgtcaatagaggtaatttcaaagaatttatcgaacagaaa
gatattgatggtgctctggtgggaggagccagtctcaaggcagaagaatttgccgagcta
gtcatgatggcttctcctgctatggttgattag

DBGET integrated database retrieval system