KEGG   Thermobaculum terrenum: Tter_0915Help
Entry
Tter_0915         CDS       T01134                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ttr  Thermobaculum terrenum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tter_0915
   01230 Biosynthesis of amino acids
    Tter_0915
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tter_0915
   00051 Fructose and mannose metabolism
    Tter_0915
   00562 Inositol phosphate metabolism
    Tter_0915
Enzymes [BR:ttr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tter_0915
Exosome [BR:ttr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tter_0915
  Exosomal proteins of bladder cancer cells
   Tter_0915
  Exosomal proteins of melanoma cells
   Tter_0915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:974491..975243
Genome map
AA seq 250 aa AA seqDB search
MRKPLVAGNWKMHTDSSQAQDLASSIVSRVSSVTDVEVVLCPPFVWLERVAKLVEETGIL
VGAQDTFWEDWGAYTGEISPLQLSEMCSYVIVGHSERRHIIGETDEIVARKARAVARAGM
VPILAVGELEQEYKEGISKEIVSNQLSAVLADGWDHEIVIAYEPVWAIGTGLAASAQYAQ
DMAAFIREQLSSYGLNQERVRILYGGSVNRGNFKEFIEQKDIDGALVGGASLKAEEFAEL
VMMASPAMVD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacctctagttgcgggtaattggaaaatgcacactgactcctctcaagctcag
gatttagcgtcatctatcgtatcgagagtttcttccgtgacggatgttgaggttgttctt
tgcccaccgtttgtttggcttgagagagtagcaaagctagttgaggagaccggcatcctc
gtcggagctcaagatacattttgggaggactggggagcatacaccggggagatatctcct
ctgcagctcagtgagatgtgcagttacgtcatagttggtcattccgaaagacggcatatt
atcggagaaactgatgaaatagtagctaggaaagctagggctgtggccagagcagggatg
gtacctatactagcggttggggagctggagcaggagtacaaagagggaatctccaaggaa
atcgttagcaatcagctctctgctgttcttgccgatggttgggatcatgaaatagtgatc
gcgtatgaacctgtttgggcgataggaacaggactggctgcttcagctcaatatgcccag
gacatggcagcctttataagggaacaacttagttcatatggcctcaatcaagagagagtt
agaatactctatggtgggagcgtcaatagaggtaatttcaaagaatttatcgaacagaaa
gatattgatggtgctctggtgggaggagccagtctcaaggcagaagaatttgccgagcta
gtcatgatggcttctcctgctatggttgattag

DBGET integrated database retrieval system