KEGG   Thermobaculum terrenum: Tter_1213Help
Entry
Tter_1213         CDS       T01134                                 

Definition
(GenBank) peptidase M42 family protein
Organism
ttr  Thermobaculum terrenum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:complement(1317897..1318931)
Genome map
AA seq 344 aa AA seqDB search
MNESLLRDLLTTPGVSGREERIRKYVIDQLSPLVDEVSVDAMGNVIGVKHGEEPSVMLSA
HMDTIGFLVSHIDDDGFIRFVSVGGFDPRTLVMQRVIVHGKDDYVGLISPSSKPIHLSRP
EDRDKAVKIEELFIDLMMPPDQVKANVQVGDPISLCREVVVNEWSFASAYLDDRIGVYIM
LEALKRASPNVKVYAVASVQEEVGLRGARTSAYGINPSIGVAIDVTIAGDIPGMDKTQQV
TSLGKGAAISIMDADSISDPRLVSQFRSVAEKYNIPYQMEILPRGGTDAGAIQQARAGVP
VITLSIPVRYIHTVNESARISDLEATIDLLSKFMEHAHEVNLSW
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtctcttttgcgtgatctgcttaccactcctggtgtatccggtagagaggaa
aggataagaaagtatgtcatagatcaactctctcctctcgtcgacgaagttagcgtcgac
gccatgggcaatgttataggggtaaagcacggagaagaacccagtgtaatgctttctgcc
cacatggatactataggatttcttgtcagccacattgatgatgacggctttatacgcttt
gtgtcggtgggaggattcgatcctaggactctcgtgatgcagagggtaatagtccatggg
aaggatgattacgtggggttgatatctccttcttctaagcctatacatctcagtagacca
gaagatcgagacaaagccgtaaagatcgaagagctctttatagatcttatgatgccgcct
gaccaagtcaaagcgaatgtgcaggtaggagatcctatttcactttgtcgagaagtagtc
gtcaatgaatggtcatttgctagcgcatacctggatgaccgtattggggtttacataatg
ctagaggctctcaagagggcttctcccaacgtcaaggtgtatgctgtggcatcggtacag
gaagaggttgggcttcggggagcccgtactagtgcttatggcataaatccaagcataggc
gttgctattgatgtaactatagctggagacatacctgggatggataaaactcagcaagtt
acatctttaggcaaaggagccgctattagcataatggacgctgattcgatttcagatcct
aggctagtttcacagttcagatctgtagcggagaagtacaatattccatatcaaatggaa
attttacctaggggaggaacggacgctggagctatccagcaagcgcgtgctggggtgcca
gtgataaccctctccattccggtaagatacatacatactgttaatgagtctgccaggata
tcggatctcgaagccactatcgatctcttgtcgaaattcatggagcatgctcatgaggtg
aatttgtcatggtaa

DBGET integrated database retrieval system