KEGG   Thermobaculum terrenum: Tter_1410Help
Entry
Tter_1410         CDS       T01134                                 

Definition
aminodeoxychorismate lyase
Orthology
K07082  
UPF0755 protein
Organism
ttr  Thermobaculum terrenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1534900..1535943
Genome map
AA seq 347 aa AA seqDB search
MNQDINRQSPDDQPARWPLFWALVILALAVPALWWYLDPTPRADASSKPVTVVVRHGEGW
NDLTDRLHRLGIIRRPLIFKALVVLSGERGHLLPGRYLIKRGTSARDLIATFTDASNQSK
ITIPEGFRLGQIEDRMLQLGLTTPQQWQEAINNPPKSPLLASKPKGVSIEGYIFPDTYIF
TEENAAQQLVREGIANMQKHLSKDIIQGFKRQGLTINEGLTLASIVEREAQIPSERPIIA
SVYLNRLRKGMPLQADPTVQYAVGKRGEWWKSPLTRQDLKSDSPYNTYVHKGLPPGPICS
PGLPSIKAVAYPAHTDYLYFVAKGDGSHAFAKTLQEHEQNIQRYLRR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggacatcaataggcaatctccagatgatcaaccagcacgttggcctctattt
tgggcattagtgattcttgccttggcagttccagcactatggtggtatttggacccaaca
cctagggcggatgcatcttctaaaccagtgacagttgtagtgagacatggagaaggctgg
aacgatcttacagatagattacacaggctagggatcataagaaggccgttaatattcaag
gcgctagtcgtgctctcaggtgagaggggtcatctcctaccaggcagatatttaataaag
aggggaacgagtgctagggatctcatagctaccttcacagatgcaagcaatcagtctaag
atcaccatccccgaaggttttaggctggggcaaattgaggacaggatgcttcaattagga
ctcactactccacaacaatggcaggaagcaatcaataacccaccaaagtctccgttatta
gcttctaagcctaagggggttagtatcgaaggttatatctttccagatacatatatcttt
acggaggagaatgctgcacagcagcttgtaagagagggaatagctaacatgcaaaagcac
ctctccaaggatataattcaaggcttcaaacgccaagggttaactataaacgaaggacta
accctggccagcattgtggaaagagaggctcaaattccgtctgagagaccaataattgcc
tcggtttatcttaatcggctaagaaagggcatgcccctgcaggctgacccaacagtccaa
tatgcagttgggaaaaggggagaatggtggaagtcccctctgacaaggcaagatctaaaa
tccgactccccttacaatacatatgtacataaggggctcccaccaggacctatctgtagc
cctggtttaccatcaataaaagccgtagcgtatcccgcccacacagattacctttatttt
gttgctaagggtgatgggtcgcatgcttttgcaaaaactttacaggaacacgaacaaaac
atacaaagataccttagaagatga

DBGET integrated database retrieval system