KEGG   Thermobaculum terrenum: Tter_1704Help
Entry
Tter_1704         CDS       T01134                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ttr  Thermobaculum terrenum
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tter_1704
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tter_1704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1842354..1843565
Genome map
AA seq 403 aa AA seqDB search
MFMYPKGEIAQPIKVAILGSTGSIGTQTLDVISSHPDKFKVVALAAGSNRKLLEEQIERF
KPQMYCLVSDKLPGGLSGPEGMLEIAASPQVDLLVVATTGSAGWEPTIEGIRNGKIIALA
NKEALVMAGRIIVSEAHKHDAIVRPIDSEHSAIWQCLQGEGLGDSKLRRPEGVKRIILTA
SGGPFRDTPLEEMKQVTPSQALAHPNWRMGNKVTIDSATLMNKGLEVIEAHWLFDMPFEQ
LDVVIHPQSIVHSMVEFNDGSIKAQLGIPDMRVPIQYALCYPEHSYNSKLGYLDFTKSLE
LQFYPPDMARFPCLSLAIEAGKKGSTYPAVLSAADDEAVAAFLEGHIGFLDISCIVEEAL
AKHEAICKDEDIDLESIRQADRWARLFVKSFIKSMKGRSRIEV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttatgtaccccaaaggtgaaattgctcagccgataaaggtagctatactcggtagt
acaggctcgataggcactcagactctggatgttataagctcacatccagataaattcaag
gttgtagccttagctgcaggcagcaaccgtaaactacttgaagagcagatagaacgtttc
aagccacaaatgtactgccttgttagcgataaactcccgggtgggctaagcggacctgag
gggatgttagagatagcggcatctcctcaggtcgacttgttagtggtggctacaaccggt
tctgccggatgggaacctaccatagaaggtataaggaacggcaagataattgccctggcc
aacaaagaagccctggtcatggcgggcagaatcatagtatctgaggcgcataaacacgat
gctatagttcggcctatagacagtgagcattctgcaatatggcaatgtctgcagggggaa
ggcttaggagattccaaattacgaagaccggaaggcgtaaagaggattatactaaccgca
tcaggcggacctttcagagatacgcctttagaggagatgaaacaagttactccatctcaa
gcgctagcccacccaaattggcgcatggggaacaaggtaactatagatagtgccactcta
atgaacaagggactagaagtaatcgaggctcactggctgtttgacatgccgtttgaacag
ctagatgtggtgatccatccccaaagcatagtgcactcaatggttgaattcaatgatggc
tcaataaaagctcaacttggcatcccagacatgcgagtgcctattcaatacgccctatgc
tatccggagcactcctacaatagcaaactagggtatctggattttactaagtcacttgag
ctgcaattctaccctccagacatggctaggtttccatgcctgagtctagctatagaagct
ggcaagaagggcagcacttatcccgcagtattgtccgctgcagatgacgaagctgtagca
gcattcttggaaggtcatataggattcctagatatatcctgtatagtagaggaagcttta
gctaagcatgaagcaatatgtaaagatgaagatatagatctagaatctattagacaggca
gataggtgggccagattatttgtaaaatccttcatcaagtccatgaagggccgtagccgt
atagaagtatag

DBGET integrated database retrieval system