KEGG   Thermobaculum terrenum: Tter_1872Help
Entry
Tter_1872         CDS       T01134                                 

Definition
magnesium protoporphyrin chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ttr  Thermobaculum terrenum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tter_1872
Enzymes [BR:ttr01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Tter_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2017278..2018672)
Genome map
AA seq 464 aa AA seqDB search
MRQARTIGELRSSGYQVRSVKDEMRQNLIRKIRRGEDLFPGIVGYEDTVIPQIENAILSG
QDIILLGERGQAKTRIARSLVNLLDDYIPAIAGCEINDNPFEPICASCRMKVEDMGDDTP
IEWIPRDRRYGEKLATPDITIADLIGEVDPIRVAEGRYLSDELTIHYGLVPRTNRGIFAI
NELPDLAERIQVGLLNIMEERDVQIRGYKIRLPLDLFVVASANPEDYTNRGRIVTPLKDR
FGSEIRTHYPEELEYEIEIMEQEGNVPEIAGVNLLVPQFMKEIIAEVTHQARRSTDINQR
SGVSVRVSVSNYETVVSSALKRAIKLDETTAAPRISDLDAMIASTCGKIELESAGDVSEE
RVVRKLIQKSILTTFNRYFQLSDFADSIVKFNSGAVIETSDLMPSEEYAKQALDWEDMRT
AVQRLGVGEHPAAVASAVEFILEGLHLSRRLNKDRMDGHAFYRR
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagacaggcgagaactataggagagcttagatcctcaggctatcaagtaaggtccgtc
aaggatgagatgaggcagaacttaatacgtaaaatccgaaggggggaggaccttttccca
ggaatagtgggttatgaggacacagttattccccagatagagaatgctatcctgtccggg
caggacataatcttgctcggagagaggggccaagcaaagactcgcatagcgcgttcattg
gtgaatctgttagatgattacatacctgcaattgcaggctgtgagatcaacgacaacccc
tttgaacccatctgcgccagctgcaggatgaaagtggaagatatgggggatgatacccct
atagagtggataccgcgtgaccgcaggtatggcgagaagctggccactcccgatatcacc
atagcagatctaataggcgaggtagatcccatccgtgtggcggaagggaggtacctgtct
gacgaacttactatccattacggattagtccctagaactaacagaggcatcttcgccatc
aatgagctacctgatcttgcagagcgtatacaggtaggcttgcttaacataatggaggag
agagacgtccaaatcagaggttacaaaataaggctgccccttgatctgttcgtcgtagca
agtgctaaccctgaggactatacaaacaggggccgcatagtaacccctctcaaagacaga
tttggctctgagatccgaactcactacccagaggaactcgagtacgagatagagatcatg
gagcaggaggggaatgtccccgagattgcgggagtgaacctgctcgtacctcagtttatg
aaagagatcatagctgaggttactcatcaggcgagaaggtcgactgatataaaccagcgc
tcgggggtgagcgtgagagtatcagttagcaactatgaaacggttgtatctagcgctcta
aagagagctatcaagcttgatgagactacagctgcacctcggatcagtgatctggatgct
atgattgcctctacttgtggcaagatagagctggagtctgcgggtgatgtaagtgaggag
cgcgtagttcgcaagctgattcagaagtccatcctgaccactttcaacagatacttccag
ctgtctgattttgctgattccatagtcaagttcaactcaggagctgttatagagacctca
gatctcatgccgtcggaggagtatgctaaacaggctcttgattgggaggatatgaggaca
gcggttcagcggcttggagtgggcgagcacccagccgcggtagcctctgcagtcgagttt
atcttagagggactgcatctaagcaggaggctaaacaaggacaggatggatgggcacgca
ttttacaggcgttag

DBGET integrated database retrieval system