KEGG   Thermobaculum terrenum: Tter_2458Help
Entry
Tter_2458         CDS       T01134                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ttr  Thermobaculum terrenum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:ttr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ttr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttr00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ttr00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttr00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ttr00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ttr00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:610842..611813
Genome map
AA seq 323 aa AA seqDB search
MILTVSPNTSTDRVYVVSGFRPGATMRSHLSFDQAGGSGAHVSGVVGQLGGESRALVVLG
GGNGLRWRAAAARQGIDYRAVEIDVENRSSVVVVDRQLGLVAEIVDGGPRLGGREHEALL
ELLRRELPAASLLVLSGSLPAGMPQDLYFSAIEVARGHGVRVIIDAHSEPMEAALGARPW
MVKVNLEEFGGLMGGYPRDMAERVGAAQEFAARHGIEVLLLSMAQEGAVLAYGGHAWHLP
VPPVPSHLPGSEGINPVGCGDAMVGAFAWAYERTGDVLEAARWGVAAAHVNLAKYEVPSC
PLPEVEAVLSFVETRMVAQEEKV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgacggtatctcccaacacctccaccgacagggtgtacgtcgtctcggggttc
cgtcccggggcgacgatgcgcagccacctgagcttcgaccaggctggggggtcgggcgcc
cacgtcagcggcgtggtggggcagttgggcggggagagcagggcgctcgtggtgctgggc
ggaggcaacggcctgcggtggcgggctgcggccgcccgccagggcatagactaccgggcg
gtggagatcgacgtcgagaacaggtcctccgtggtggtggtggacaggcagctggggttg
gtggccgagatcgtggatggggggccgcggctggggggaagggagcacgaggccctgctg
gagctgcttaggcgggagctgccggcggcctccctgctggtgctctccggcagcctgccc
gccggcatgccccaggacctgtacttctcggcgatcgaggtggccagggggcacggagtg
agggtcatcatcgacgcgcactcggagcctatggaggccgcgctgggggctcgtccatgg
atggtgaaggtcaacctggaggagttcggggggctcatggggggataccccagggacatg
gctgagagggtgggggcagcgcaggagtttgccgcccgacatgggatcgaggtgttgctg
ctctccatggcgcaggagggggccgtgttggcctatggggggcatgcctggcacctgcca
gtgcccccggttcccagccacctgccgggctcggagggcatcaatccagtggggtgcggc
gacgccatggtgggggcattcgcctgggcctacgaacggacgggcgatgtactggaggcc
gcccgctggggagtggcggcggcgcacgtcaacttggccaagtacgaggtgccctcgtgc
ccgctgcccgaggtggaggcggtgctgagtttcgtggagaccaggatggtggcgcaggag
gagaaggtatga

DBGET integrated database retrieval system