KEGG   Thermobaculum terrenum: Tter_2458Help
Entry
Tter_2458         CDS       T01134                                 

Definition
(GenBank) 1-phosphofructokinase
Organism
ttr  Thermobaculum terrenum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2:610842..611813
Genome map
AA seq 323 aa AA seqDB search
MILTVSPNTSTDRVYVVSGFRPGATMRSHLSFDQAGGSGAHVSGVVGQLGGESRALVVLG
GGNGLRWRAAAARQGIDYRAVEIDVENRSSVVVVDRQLGLVAEIVDGGPRLGGREHEALL
ELLRRELPAASLLVLSGSLPAGMPQDLYFSAIEVARGHGVRVIIDAHSEPMEAALGARPW
MVKVNLEEFGGLMGGYPRDMAERVGAAQEFAARHGIEVLLLSMAQEGAVLAYGGHAWHLP
VPPVPSHLPGSEGINPVGCGDAMVGAFAWAYERTGDVLEAARWGVAAAHVNLAKYEVPSC
PLPEVEAVLSFVETRMVAQEEKV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgatcctgacggtatctcccaacacctccaccgacagggtgtacgtcgtctcggggttc
cgtcccggggcgacgatgcgcagccacctgagcttcgaccaggctggggggtcgggcgcc
cacgtcagcggcgtggtggggcagttgggcggggagagcagggcgctcgtggtgctgggc
ggaggcaacggcctgcggtggcgggctgcggccgcccgccagggcatagactaccgggcg
gtggagatcgacgtcgagaacaggtcctccgtggtggtggtggacaggcagctggggttg
gtggccgagatcgtggatggggggccgcggctggggggaagggagcacgaggccctgctg
gagctgcttaggcgggagctgccggcggcctccctgctggtgctctccggcagcctgccc
gccggcatgccccaggacctgtacttctcggcgatcgaggtggccagggggcacggagtg
agggtcatcatcgacgcgcactcggagcctatggaggccgcgctgggggctcgtccatgg
atggtgaaggtcaacctggaggagttcggggggctcatggggggataccccagggacatg
gctgagagggtgggggcagcgcaggagtttgccgcccgacatgggatcgaggtgttgctg
ctctccatggcgcaggagggggccgtgttggcctatggggggcatgcctggcacctgcca
gtgcccccggttcccagccacctgccgggctcggagggcatcaatccagtggggtgcggc
gacgccatggtgggggcattcgcctgggcctacgaacggacgggcgatgtactggaggcc
gcccgctggggagtggcggcggcgcacgtcaacttggccaagtacgaggtgccctcgtgc
ccgctgcccgaggtggaggcggtgctgagtttcgtggagaccaggatggtggcgcaggag
gagaaggtatga

DBGET integrated database retrieval system