KEGG   Thermobaculum terrenum: Tter_2516Help
Entry
Tter_2516         CDS       T01134                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ttr  Thermobaculum terrenum
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tter_2516
Enzymes [BR:ttr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Tter_2516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:677689..679701
Genome map
AA seq 670 aa AA seqDB search
MRALDLLLGVCYYPEQVDPSEWEADLARIREAGLDTVRIGELIWSGLEPEPGRFRCEWLD
EVLELCRGYGLAVVLGTPTATLPPWLVEADPEVMPVDDRGVRAAYGSWGTACLSSQLLWA
RTELLVDELGRRYGRHPAVIGWQLDNELPATTCYCQRCRSSFHNWLERRYGDVSALNEAW
GTAFLGQGYTRWGQVPAPLATVRVGRQNPGLLLDYVRFQSELACRYLERQAEILRRRSPG
RRLTHNIPGMAAHIDYHRLFGPLDVAAWDVYPGWIGGLPHRLALGHDVVRGLKRAGYWVL
EQQVGRLEHRAPPAGALRLWTYQAVAHGAEVVLYFPWRQARGGSEQYIASLLTPDGRRTR
SLAEVERAARELQQLAPLLRGTEPRGDVALLWSYEDHWALALQPQVPELADPWRYPEEWY
LALRRADLQVDVLSPSDDRLRDYRLLVAPSLYLATASLAERLRGYVEAGGTLLLGPRSGS
KDEHNAWPRGPLPGPLGELVGATVEEFEGLPGGEARTLRWAHGDGRLSARAWCELLAPAG
AEPLLLYADGPWPGSPAAVRRQLGAGRAYYLGCMGEEVVAGVLLEALRGAGVARGPSVPA
GGELVVRAGGGRALYFVLNHAAQEARLALPAGRAYQDPWTGDARPAEVELPPYGVEVLLA
YVGQEVQGAS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgagagccttggacctcctcctaggtgtttgttactatccagagcaggtcgatccctct
gagtgggaggctgacctggcgcgcatccgcgaggccggcctggacaccgtgcggataggg
gagctcatctggtcgggcttggagcccgagcccggccgcttccgctgtgagtggctggac
gaggtgctggagctgtgccgtgggtacgggctcgccgtggtgctgggcacgcccacagca
acgctgcccccctggctcgtcgaagccgatccggaggtgatgccggtcgatgatcgcggc
gtgcgggcggcctacggctcctggggaaccgcctgcctgagcagccagctgctgtgggcg
cggaccgagctgctggtggacgagctggggcggcggtacgggaggcacccggccgtgatc
ggctggcagctggacaacgagctccctgccactacctgttactgtcagcggtgcagatcg
agctttcacaattggctggagcgcaggtatggtgacgtgtcggcgctcaacgaggcgtgg
gggacagcgttcctcggtcaggggtacacccgctgggggcaggtgccagcgccgctggcc
accgtgcgcgtcggccgccagaacccgggcctgctgctggactacgtgcggttccagtcg
gagctggcctgccggtacctcgagcggcaggccgagatcctccggcggcgctctccgggg
aggcgcctgacgcacaacatcccaggcatggcggcgcacatcgattaccaccggctcttc
ggcccgctggacgtcgcggcgtgggacgtctaccccgggtggataggggggctaccccac
cgcctcgcgctcgggcacgacgtggtgcgggggttgaagcgcgccggctactgggtgctg
gagcagcaggtggggaggctggagcacagggcacctcccgcgggggcgctgaggctgtgg
acctaccaggcggtcgcgcacggggccgaggtcgtgctgtacttcccctggaggcaggcc
aggggaggctccgagcagtacatagcctccctcctcacccccgacggcaggcggacgcgc
tcgctggcggaggtcgagcgggcggcgcgcgagctgcagcagctcgcccctctgctccgg
ggcaccgagcctcgcggcgacgtcgcgctcctgtggagctacgaggaccactgggcgctg
gccctccagccccaggtgcccgagctggccgacccttggaggtacccggaggagtggtac
ctggcgctgcggcgtgccgacctccaggtggacgtgctctcgccgtcggacgaccgcctg
cgggattaccgcctgctcgtggccccctcgctctatctggccaccgccagcctcgcggag
cggctgaggggatacgtcgaggcggggggcacgctcctgttggggccgcgctcggggtcg
aaggacgagcacaacgcttggcccagggggccgttgcccggccccctgggcgagctggtg
ggcgcgacggtggaggagttcgaggggctgcccgggggagaggccaggaccctgcgctgg
gcgcacggcgacggcaggctctcggcccgggcctggtgcgagctgctcgcccccgcgggc
gcggagccgctgctgctgtacgcggacgggccgtggccgggatcgccggccgccgtgcgt
cgccagctgggcgccgggagggcctactacctgggctgcatgggcgaggaggtggtcgcg
ggcgtcctcctcgaggcgctccgcggcgcgggcgttgcgcggggtccgtccgtgcctgcg
gggggcgagctggtggtgcgggccggagggggccgagcgctgtacttcgtgctcaaccac
gcggcgcaggaggcccggctcgccctgccagctggcagggcgtaccaggatccctggacg
ggggacgctcgcccagcggaggtcgagctgccgccgtacggcgtggaggtgctgctggcg
tacgtaggacaggaggtgcaaggtgcgtcttga

DBGET integrated database retrieval system