KEGG   Thermobaculum terrenum: Tter_2599Help
Entry
Tter_2599         CDS       T01134                                 

Definition
NAD-dependent epimerase/dehydratase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
ttr  Thermobaculum terrenum
Brite
Enzymes [BR:ttr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Tter_2599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:772000..772974
Genome map
AA seq 324 aa AA seqDB search
MRYLVTGATGFIGSKLVWELLQRGHEVVALVRNPRKSGALRELGAEVRHGDITDRSAVVA
AMRDVDGVFHVAARYKIGDRDKQALYRTNVEGTRQVLEAMAELGIPRGVYTSSIAVFSDT
KGHIPDESYRHEGPFLNEYERTKWIAHYEVALPMIARGLPLVIVMPGVVYGPGDTSLVHT
LLRLYLRGVLLAVPGGVTYSWTYVDDVVEGHISAMERGREGESYILAGPGVSLREVLRVA
SELTGVPAPKLEVPPRLISMASVLASGLERVVPLPPLLASETLRTIAGTTYLGNSAKAGR
ELGFSPRELREGLEPTLQYEKSRL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacctggtgaccggtgccaccgggttcataggttcgaagctagtctgggagcta
ctgcagcgcggccacgaggtggtggcgctggtacgcaatcccaggaagagcggtgccctg
cgggagctaggggctgaggtgaggcacggagacatcaccgacagatccgcggtggtggcg
gccatgcgggacgtggacggcgtgttccacgtggccgcgcgctataagataggggatcgc
gacaagcaggccctctacaggaccaacgtcgagggcactcgccaagtgctggaggccatg
gccgagctcgggatacctcgcggggtgtacaccagcagcatagcggtcttctcggacacc
aagggccacataccagacgagtcctacaggcacgaggggccgttcctcaacgagtacgag
cgcaccaagtggatcgctcactacgaagtagcactgccgatgatcgcccgggggctgccg
ctggtgatcgtcatgcccggcgtcgtctacggtccaggggacaccagcctcgtgcacacc
ctcctgcggctgtacctgcgaggcgtgttgctggccgtgcctggaggcgtgacttactcc
tggacctacgtcgacgacgtggtcgagggccacatctcggccatggagcgaggcagggag
ggggagagctacatcctggccggccccggggtctcgctgcgggaggtgctgcgggtggcc
tccgagctcaccggtgtgccggcccccaagctggaggtgcccccaaggctcatctcgatg
gcctccgtgctcgcctcgggcctggagcgggtggtgccgctcccgccgctgctggcctcc
gagacgctacggaccatcgcaggcaccacctacctggggaacagcgcgaaggccgggcgg
gagctcgggttctctccccgcgagcttcgggagggcctggagcccaccctgcagtacgag
aaatcaaggctttga

DBGET integrated database retrieval system