KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0094Help
Entry
Ththe16_0094      CDS       T01867                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tts00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ththe16_0094
Enzymes [BR:tts01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Ththe16_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(86958..87533)
Genome map
AA seq 191 aa AA seqDB search
MIRYLRGLVLKKEAGGFVLLAGGVGFFLQAPAPFLQALEEGKEVGVHTHLLLKEEGLSLY
GFPDEESLALFELLLSVSGVGPKVALALLSALPPRLLARALLEGDARLLTSASGVGKRLA
ERIALELKGKVPPHLLAGEKVESEAAEEAVMALAALGFKEAQARAVVLDLLAQNPKARAQ
DLIKEALKRLR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgatccgctacctccggggcctggtcctcaagaaggaggcgggcggcttcgtccttctc
gccgggggggtggggttcttcctccaggcccctgcgcccttcctccaggccctggaggaa
gggaaggaggtgggggtccacacccacctcctcctcaaagaggaggggctatccctctac
ggcttccccgacgaggagagcctcgccctctttgaactcctcctctcggtgagcggggtg
gggcccaaggtggccctcgccctcctctcggccctgccccccaggctcctcgcccgggcc
ctcctggagggggatgcgaggctcctcacctcggcgagcggggtggggaaaaggctcgcc
gaaaggatcgccctggagctcaaggggaaggtgcccccccacctcctcgccggggagaag
gtggagagcgaggccgcggaggaggcggtgatggccctcgccgccctggggttcaaggag
gcccaggcgcgggcggtggtcctggacctcctggcccaaaaccccaaggcccgggcccag
gacctcatcaaggaggccctaaagcgcctccgctag

DBGET integrated database retrieval system