KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0097Help
Entry
Ththe16_0097      CDS       T01867                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00020  Citrate cycle (TCA cycle)
tts00310  Lysine degradation
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
Module
tts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ththe16_0097
  Amino acid metabolism
   00310 Lysine degradation
    Ththe16_0097
Enzymes [BR:tts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ththe16_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: AEG32535
UniProt: F6DHT6
Position
91074..92294
Genome map
AA seq 406 aa AA seqDB search
MQELKVPSVGESIVEVEIGAWLKGEGESFAQDEPLVELITDKATLELPAPFAGTLKQILK
KTGETARVGEAIALLEEGRAEAAPKAQAPAEAPKEPSPEPLAMPAAERLMQEKGVSPAEV
QGTGLGGRILKEDVMRHLEERAPAKPVEAPPPPPPSRPAPPPSTPTQAPADKPWRVSEAV
PMTPLRRRIAERLLMVRQTTAMLTTFNEADMSAVIALRKEFGEAFQKKYGVKLGFMSFFV
KAVVQALKEIPELNAEIRDNHIVYHRYYDIGIAVGGGEGLVVPVIRDADRLSFAEIERQI
ADFAERARTKKLKPEELMGGTFTITNGGIYGSLNSTPLLNPPQVGILGMHAIQERPVARD
GQVVIRPMMYLALSYDHRIVDGREAVTFLRRVKELIENPARLLLEV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgcaggaactcaaggtgccctccgtgggcgaaagcatcgtggaagtggagatcggcgct
tggcttaagggagaaggggagagcttcgcccaggacgagcccttggtggagctcatcacc
gacaaggccaccttggagctccccgcccccttcgccggtaccctgaagcagatcctgaag
aagaccggggagaccgcccgggtgggggaggccatcgccctcctggaggaggggagggcg
gaggccgcgcccaaggcccaggcgcccgccgaggcccccaaggagccctccccggagcct
ttggccatgcccgccgcggagcgcctcatgcaggaaaagggcgtctccccggcagaggtc
caggggacgggcctcggcgggcggatcctcaaggaggacgtgatgcgccacctggaggaa
agggcccccgccaagcccgtggaagccccgccgccccctcccccctcccgccccgcgccc
ccgccctccacccccacgcaggcccccgccgacaagccctggcgggtgagcgaggccgtg
cccatgacgccccttcgccgccggatcgccgagcgcctcctcatggtccgccagaccacg
gccatgctcaccaccttcaacgaggcggacatgtcggcggtgatcgccctcaggaaggag
ttcggcgaggccttccagaagaagtacggggtcaagctcggcttcatgagcttcttcgtc
aaggccgtggtccaggccctcaaggagatccccgagctcaacgccgagatccgggacaac
cacatcgtctaccaccgctactacgacatcggcatcgccgtgggcggaggcgagggcctg
gtggtccccgtgatccgcgacgccgaccgcctctccttcgccgagattgagcggcagatc
gccgattttgccgaaagggcccgcaccaagaagctcaagcccgaggagctcatggggggc
accttcaccatcaccaacggggggatctacggctccctgaactccacccccctcctcaac
ccgccccaggtgggcatccttggcatgcacgccatccaggaaaggcccgtggcccgggac
ggccaggtggtcataaggcccatgatgtacctcgccctctcctacgaccaccgcatcgtg
gacgggcgggaggcggtcaccttcctccgccgggtgaaggagctcattgagaacccggcg
cggctccttttggaggtgtag

DBGET integrated database retrieval system