KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0158Help
Entry
Ththe16_0158      CDS       T01867                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0158
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0158
   00020 Citrate cycle (TCA cycle)
    Ththe16_0158
   00620 Pyruvate metabolism
    Ththe16_0158
Enzymes [BR:tts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ththe16_0158
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(148078..149433)
Genome map
AA seq 451 aa AA seqDB search
MPKEILMPELAESVVEGEILKWLVEEGDYLKKDQPFVEVMTDKVTVELPSPYEGVLLKKL
AKEGEVVKVHAPIALIAEPGEAVEGVKEPPPVQAAEERSIVEPGLPAKEEKEDLSLFKPD
PTQVAVKNPFLSGEKPQEGARPGRVLAVPAARKLARELGIPIEEVPGSGPLGRVRVEDVR
AYAERRKAPPERPEEGPQVLPAGFPPPPKYAPPKGYEHLEERVPLRGIRRTIAQGLWQSH
LYTVRTLNVDEADLTELVRLRERLKPQAEAQGVKLTYLPFIVKAVVRALKKFPMLNTSLD
EERQEIVYKRYYHIGLAVATERGLIVPVVRDADRKSVLELAQEIAELSQKAREGRLAPEE
VTGSTFTITNIGSVGATLSFPIIHLPDAAILGVHSIRKRPWVMPDGSIRPRDIMFLSLSF
DHRLVDGAEAAMFTREVIRLLENPDLLLLEM
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaggaaatcctcatgcccgagctcgccgaaagcgtggtggaaggcgagatcctg
aagtggctcgtggaggaaggggactacctgaagaaggaccagcccttcgtggaggtcatg
accgacaaggttacggtggagctgccctccccttacgagggggtgctcctgaagaagctg
gccaaggagggggaggtggtcaaggtccacgcccccatcgccctcatcgccgagcccggc
gaggcggtggagggcgtgaaggagccccccccggtgcaggcggcggaggagcgctccatc
gtggagccgggcctgcccgcgaaggaggagaaggaggacctctccctcttcaagccggac
cccacgcaggtggcggtgaaaaaccccttcctctccggggaaaagccccaggagggggcg
aggccggggcgggtcctcgccgtccccgccgcccggaagctcgcccgggagctcgggatc
cccattgaggaggtgccgggctcggggcctttgggcagggtccgggtggaggacgtccgg
gcctacgccgagcggaggaaagcccctcccgaaaggcccgaggaggggccccaggtgctt
cctgccggcttcccacccccgcccaagtacgccccgcccaaggggtacgagcacctggag
gagcgggtgcctctaaggggcatccgccgcaccatcgcccagggactctggcagagccac
ctctacacggtgcgtaccctcaacgtggacgaggccgacctcacggagctcgtgcgcctg
cgcgagcgcctcaagccccaggccgaggcccagggggtcaagctcacctacctgcccttc
atcgtcaaggcggtggtgcgggccctgaagaagttccccatgctgaacaccagcctggac
gaggaaaggcaggagatcgtctacaagcgctactaccacatcggcctcgccgtggccacg
gaaaggggcctcatcgtccccgtggtgcgggacgcggaccggaagagcgtcttggagctc
gcccaggagatcgccgagctctcccagaaggcgcgggaaggccgcctcgccccggaagag
gttacggggtccaccttcaccatcaccaacatcggctccgtgggggccaccttgagcttc
cccatcatccacctgccggacgcggccatcctcggcgtgcactccataaggaagcgcccc
tgggtcatgccggacggttccataaggccgcgggacatcatgttcctctccctctccttt
gaccaccgcctggtggacggggccgaggcggctatgttcacccgggaggtcataaggctc
ttggaaaaccccgacctgctccttctggaaatgtag

DBGET integrated database retrieval system