KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0173Help
Entry
Ththe16_0173      CDS       T01867                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00071  Fatty acid degradation
tts00280  Valine, leucine and isoleucine degradation
tts00281  Geraniol degradation
tts00310  Lysine degradation
tts00360  Phenylalanine metabolism
tts00362  Benzoate degradation
tts00380  Tryptophan metabolism
tts00410  beta-Alanine metabolism
tts00627  Aminobenzoate degradation
tts00640  Propanoate metabolism
tts00650  Butanoate metabolism
tts00903  Limonene and pinene degradation
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01212  Fatty acid metabolism
Module
tts_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ththe16_0173
   00650 Butanoate metabolism
    Ththe16_0173
  Lipid metabolism
   00071 Fatty acid degradation
    Ththe16_0173
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ththe16_0173
   00310 Lysine degradation
    Ththe16_0173
   00360 Phenylalanine metabolism
    Ththe16_0173
   00380 Tryptophan metabolism
    Ththe16_0173
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ththe16_0173
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ththe16_0173
   00281 Geraniol degradation
    Ththe16_0173
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ththe16_0173
   00627 Aminobenzoate degradation
    Ththe16_0173
   00930 Caprolactam degradation
    Ththe16_0173
Enzymes [BR:tts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ththe16_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEG32609
UniProt: F6DI83
Structure
PDB: 

Jmol
Position
complement(159387..160181)
Genome map
AA seq 264 aa AA seqDB search
MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLL
RGEGGVFSAGGSFGLIEEMRASHEALMRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL
ALALAADIAVAGKGARLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEA
ERLGLVALAVEDEKVYAKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEF
LGFSGKELEEGLKALKEKRPPEFP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctctttggaagcccgctacccggggctcgccttcgcctggccgaggcccggc
gtcctggagatcaccttccgcggggagaagctcaacgccatgccccctgccctccaccgg
ggcctggcccgggtgtggcgggacctcgaggcggtggaaggcgtaagggccgtgctcctt
cggggcgagggcggggtcttctccgccgggggctccttcggcctcattgaggagatgcgg
gcctcccacgaggccctgatgcgggtcttctgggaggcccgcgacctcgtgctcgggccc
ctcaacttcccgaggcccgtggtggcggcggtggagaaggtggcggtgggggcggggctc
gccctggccctcgccgccgacatcgccgtggcggggaagggggcgaggcttcttgacggc
cacctccgcctcggggtggcggcgggggaccacgccgtgctcctatggcccctcctcgtg
ggcatggccaaggccaagtaccacctcctcctcaacgagcccctcacgggggaggaggcg
gagcgcctgggcctcgtggccttggcggtggaggacgaaaaggtctacgcgaaggccctc
gaggtggcggaaaggctcgcccaaggccccaaggaggccctccaccacaccaagcacgcc
ttaaaccactggtaccggagcttcctcccccactttgagctctccttggccctggagttt
ttagggttttccgggaaggagctggaggagggcctcaaggccctcaaggagaagcgcccc
cccgagttcccatga

DBGET integrated database retrieval system