KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0173Help
Entry
Ththe16_0173      CDS       T01867                                 

Definition
(RefSeq) Enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Ththe16_0173
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Ththe16_0173
   00650 Butanoate metabolism
    Ththe16_0173
  Lipid metabolism
   00071 Fatty acid degradation
    Ththe16_0173
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ththe16_0173
   00310 Lysine degradation
    Ththe16_0173
   00360 Phenylalanine metabolism
    Ththe16_0173
   00380 Tryptophan metabolism
    Ththe16_0173
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Ththe16_0173
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Ththe16_0173
   00281 Geraniol degradation
    Ththe16_0173
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ththe16_0173
   00627 Aminobenzoate degradation
    Ththe16_0173
   00930 Caprolactam degradation
    Ththe16_0173
Enzymes [BR:tts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Ththe16_0173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(159387..160181)
Genome map
AA seq 264 aa AA seqDB search
MLASLEARYPGLAFAWPRPGVLEITFRGEKLNAMPPALHRGLARVWRDLEAVEGVRAVLL
RGEGGVFSAGGSFGLIEEMRASHEALMRVFWEARDLVLGPLNFPRPVVAAVEKVAVGAGL
ALALAADIAVAGKGARLLDGHLRLGVAAGDHAVLLWPLLVGMAKAKYHLLLNEPLTGEEA
ERLGLVALAVEDEKVYAKALEVAERLAQGPKEALHHTKHALNHWYRSFLPHFELSLALEF
LGFSGKELEEGLKALKEKRPPEFP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggcctctttggaagcccgctacccggggctcgccttcgcctggccgaggcccggc
gtcctggagatcaccttccgcggggagaagctcaacgccatgccccctgccctccaccgg
ggcctggcccgggtgtggcgggacctcgaggcggtggaaggcgtaagggccgtgctcctt
cggggcgagggcggggtcttctccgccgggggctccttcggcctcattgaggagatgcgg
gcctcccacgaggccctgatgcgggtcttctgggaggcccgcgacctcgtgctcgggccc
ctcaacttcccgaggcccgtggtggcggcggtggagaaggtggcggtgggggcggggctc
gccctggccctcgccgccgacatcgccgtggcggggaagggggcgaggcttcttgacggc
cacctccgcctcggggtggcggcgggggaccacgccgtgctcctatggcccctcctcgtg
ggcatggccaaggccaagtaccacctcctcctcaacgagcccctcacgggggaggaggcg
gagcgcctgggcctcgtggccttggcggtggaggacgaaaaggtctacgcgaaggccctc
gaggtggcggaaaggctcgcccaaggccccaaggaggccctccaccacaccaagcacgcc
ttaaaccactggtaccggagcttcctcccccactttgagctctccttggccctggagttt
ttagggttttccgggaaggagctggaggagggcctcaaggccctcaaggagaagcgcccc
cccgagttcccatga

DBGET integrated database retrieval system