KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0200Help
Entry
Ththe16_0200      CDS       T01867                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ththe16_0200
Enzymes [BR:tts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Ththe16_0200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
186282..187127
Genome map
AA seq 281 aa AA seqDB search
MRTLWLRDRALDLDRVRLMGVLNLTPDSFSDGGRYLDPERALERAREMVAEGADILDLGA
ESTRPGAAPVPVEEEKRRLLPVLEAVLSLGVPVSVDTRKPEVAEEALKLGAHLLNDVTGL
RDERMVALAARHGVAAVVMHMPVPDPATMMAHARYRDVVAEVKAFLKAQAEKALGAGVPQ
VVLDPGFGFGKLLEHNLALLRRLDEIVALGHPVLVGLSRKRTIGELSGVEDPAQRVHGSI
AAHLFAVTKGARLLRVHDVRAHREALRVWEALYGGDRPSRA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgcggacgctctggcttcgggaccgggccctggacctggaccgggtgcggctcatgggg
gtgctcaacctcacccccgattccttctccgacgggggccggtacttggacccggagcgg
gcccttgagcgggcccgggagatggtggccgagggggcggacattctggatttgggggcc
gagtccacccgccctggggcggcgcctgtgcccgtggaggaggagaagcggaggcttctt
cccgtcctcgaggcggtcctttccctgggggtaccggtgagcgtggacacccgcaagccc
gaggtggccgaggaggccctaaagcttggggcccaccttctgaacgacgtcaccgggctt
cgggacgagcgcatggtggccctggccgcccgccacggggtggccgccgtggtcatgcac
atgcccgtgccggacccggccaccatgatggcccacgcccgctaccgggatgtggtggcc
gaggtcaaggccttccttaaggcccaggcggagaaggcccttggagcgggggttccccag
gtggttctggacccggggtttggcttcggcaagcttttggagcacaacctcgccctcctc
cgccgcctggacgagatcgtggccctgggtcacccggtcttggtggggctttcccgcaag
cgcaccatcggggagctttccggggtggaggacccggcccagagggtccacggctccata
gccgcccacctcttcgctgtgacgaagggggcgaggttgcttcgggtccacgacgtgcgg
gcccaccgggaggcccttagggtttgggaggcgctgtatgggggagatcgcccttctcgg
gcttga

DBGET integrated database retrieval system