KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0207Help
Entry
Ththe16_0207      CDS       T01867                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0207
   00020 Citrate cycle (TCA cycle)
    Ththe16_0207
   00620 Pyruvate metabolism
    Ththe16_0207
Enzymes [BR:tts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Ththe16_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
193346..194617
Genome map
AA seq 423 aa AA seqDB search
MEVKLPELGDNVTQATVVGVLVKEGDRVEPGQPLLELETDKAVVEVPAEAGGVVQKVLVK
VGDEVRPGQPILVLAGEAEAKAEEKPEPPAPKAEEKPEPAPKAQEEPPPAPKEAPPAPKE
VPAEGRLIPAAPSIRRLARELGVDLAQVRGTGLAGRITEEDVRRAAGLAEAPAGPLPAPA
PRLPDFSKWGPVRTEPMSGVRKATARAMAQAWSQVPMVTHFDEADITELEALRKRYAKRA
EERGFRLTLTAFLLKALALTLKAFPKFNASLDPEKGEVIYKDYIHIGVAVDTPHGLLVPV
IRHVDQKGVLRLAEELQEISQRARERKLSPEEMQGATFSLSNLGGIGGTGFTPIVNWPEV
AILGVSRSQTKPLWDPGKEAFVPRLVMPFSLTYDHRLIDGADAARFCRHLAGILEDPLGL
ALA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaagctacctgaactcggcgacaacgtgacccaggccaccgtggtgggcgtc
ttggtgaaggagggggaccgggtggagccgggccagccccttctggagctggagacggac
aaggcggtggtggaggtgcccgcagaggcgggcggggtggtgcagaaggttctggtcaag
gtgggggacgaggtgcgcccgggccagcccatcttggtgctggccggggaggcggaagct
aaggcggaggagaagccggagccgcccgctcccaaggccgaggagaagcccgaaccagcc
cccaaggcccaggaagaaccccctcccgctcccaaggaagcccctcctgcgcccaaggag
gtccccgccgagggccgccttatcccggcggctccctccataaggcggctcgcccgggag
cttggggtggacctcgcgcaggtccggggcacggggcttgccgggcgcatcaccgaggag
gacgtgcgccgggcggcgggcctcgccgaggccccggcaggcccccttccggcccccgcc
cccaggcttcccgacttcagcaagtggggcccggtgcgcaccgagcccatgagcggggtg
cgcaaggccacggcgcgggccatggcccaggcctggagccaggtgcccatggtcacccac
tttgatgaggcggacatcaccgagctggaggccttgcgcaagcgctacgccaagcgggcg
gaggagagaggcttccgcctcaccctcaccgccttcctcctcaaggccctggccctcacc
ctgaaggccttccccaagttcaacgcctcccttgaccccgagaaaggggaggtcatctac
aaggactacatccacatcggggtggcggtggacacgccccatggccttttggtgccggtg
atccgccacgtggaccagaagggggttttgcgcctggcggaggagcttcaggagatctcc
caaagggcccgggagcggaagctctcccccgaggagatgcagggggccaccttcagcctc
tccaacctgggggggatcggcggcaccggcttcacccccatcgtcaactggccggaggtg
gccatcctcggggtctcccgctcccagacgaaacccctttgggaccccgggaaggaggcc
ttcgtgccccggctcgtgatgcccttcagcctcacctacgaccaccgcctcattgacggg
gccgacgccgcccgcttctgccgccacctggcggggattctggaggaccccctgggcctc
gccctagcctag

DBGET integrated database retrieval system