KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0219Help
Entry
Ththe16_0219      CDS       T01867                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ththe16_0219
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Ththe16_0219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
207671..208498
Genome map
AA seq 275 aa AA seqDB search
MERLAPAKVNLGLSVRFRREDGYHELHTLFAPFSLADRLVVEPVSAGLHFQGPYGRENLA
YRAAALYLEAAGQPGGVRILLEKRIPEGAGLGGGSSDAAQVLLALQALYPAEVDLFALAR
TLGADVPFFLLGQGAEARGVGERLKPLALPPVPAVVFFPGPRVPTPLVYRAVRPEDFGPD
LPVEAILEALARGEEPPYWNSLEGPAFRLFPELKEVRGRMRALGLRGVLMSGSGSAFFGL
AEGPDHARRAAEALRAWGRAWAGTLGGGDAGSGPA
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcctagcccctgcgaaggtcaacctcgggctttccgtccgcttccggcgggag
gacgggtaccacgagctccacaccctcttcgcccccttctccctggcggaccggctggtg
gtggagcccgtttcggcgggcctccacttccaggggccttacgggcgcgagaacctggcc
taccgggcggctgccctctacctcgaggcggcgggccaacccgggggcgtgcgcatcctt
ttggagaagcggatccccgagggggccgggcttgggggcgggagttccgacgcggcccag
gtccttctcgccctccaggccctctacccggcggaggtggacctcttcgccctggcccgg
accctcggggcggacgtccccttcttcctcctcgggcagggggcggaggcccggggggtg
ggggagaggcttaagcccctcgccttgcccccggtccccgcggtggtcttctttcccggg
ccccgggtgcccacgcccctggtctaccgggccgtgcggccggaggacttcggcccggac
ctccccgtggaggccatcctcgaggccttggcccggggggaggagcccccgtactggaac
agcctggagggccccgccttccgcctcttccccgagctcaaggaggtgcggggccggatg
cgggctttggggcttaggggggtgctcatgtcgggctcggggagcgccttcttcgggctt
gcggaaggcccggaccacgcgaggcgggcggcggaggcgcttagggcctgggggcgcgcc
tgggccggcacgctgggaggtggggatgctgggtctggacctgcttaa

DBGET integrated database retrieval system