KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0246Help
Entry
Ththe16_0246      CDS       T01867                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Ththe16_0246
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ththe16_0246
Enzymes [BR:tts01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Ththe16_0246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(230407..231705)
Genome map
AA seq 432 aa AA seqDB search
MREGAKNVGVSRVLYVEGGTPLKGELRVYPAKNAALPILAASLLTPEPITLVEVPKLRDV
EVMLELLAHLGTQYAWEGRTLHLQTPEIKNTHAPYELVGQMRASFIVWGALLARAGEGHV
SMPGGCAFGFRPVDQHIKALEALGAEVWEEDGTFHARRTRPLSGRVVFDLPTVGGTEQAM
LAVALGGEATLVQAAVEPEVVDLGHFLALLGAEVEGLGSPIVRIKGAPRLKGGTYRIIPD
RIEAGTYLLAAAATRGSLTLEGVRPDHLDALLDKLWRSGHRLEVGEDWIRFRATPDPAPF
HVEAREYPGFPTDLQPIATAYLATVPGQSTVVDRIYPDRFTHVGELARMGAELYLRDRIL
TVQGRRLHGAQVKALDIRAGGALVVAALSAEGASEIEGVYFLERGYEHLTERLQALGARV
HLRESPVALAAD
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagggggcgaaaaacgtgggcgtgagccgggtgctgtacgtggaaggcggcacc
cccttgaagggggagcttagggtttacccggccaagaacgccgccctgcccatcctcgcc
gcaagcctcctcacccccgagcccattaccctggtggaggtaccgaagcttagggacgtg
gaggtgatgctggagcttttagcccacctgggcacccagtacgcctgggagggccggacc
ctccacctccaaacccccgagatcaagaacacccacgccccctacgagctcgtgggccag
atgcgggcgagcttcatcgtctggggggccctcctcgcccgggccggggaggggcacgtc
tccatgccgggggggtgcgccttcggcttccgccccgtggaccaacacatcaaggccctc
gaggccctgggggcggaggtctgggaggaggacggcaccttccacgcccgcaggacccgc
cccctctcggggcgggtggtctttgacctgcccaccgtggggggcacggagcaggccatg
ctggccgtggccctgggcggggaggccaccctggtccaggcggcggtggagcccgaggtg
gtggacctgggccacttcctcgccctcctcggggccgaggtggaggggctgggaagcccc
atcgtccgcatcaagggggcgccccggctaaagggcggcacctaccgcatcatccccgac
cgcatagaggccgggacctacctcctggcggcggccgccacccggggaagcctcaccctg
gaaggcgtgcgccccgaccacctggacgccctcttggacaagctttggcgctcggggcac
cggctggaagtgggggaggactggatccgtttccgggccaccccggaccccgcccccttc
cacgtggaggcccgggagtacccgggctttcccacggacctccagcccatcgccaccgcc
tacctggccaccgttcccggccagagcacggtggtggaccgcatctatcccgaccgcttc
acccacgtgggggagctggcccgcatgggggcggagctctacctgcgggaccggatcctc
accgtccagggcaggcggctccacggcgcccaggtcaaggccctggacatccgggccgga
ggggccttggtggtggcggccctgagcgccgaaggcgcctcggagattgagggcgtctac
ttcttggagcggggctacgagcacctcacggaaaggctccaggccctgggggcccgggtg
cacctccgggaaagccccgtggccctggccgccgactga

DBGET integrated database retrieval system