KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0285Help
Entry
Ththe16_0285      CDS       T01867                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tts00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tts00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(266553..268001)
Genome map
AA seq 482 aa AA seqDB search
MPTLKELFTLFGKEAPEVPVRGLTLDSRRVEPGFVFVAVPGVPLPHRKPLDGHDFVPEAL
ARGAVAVVGERPLALPVPYLQVADGRQALALLARRFHGEPDRELLLVGVTGSKGKSTTAS
LLHHLLQRAQGGSALLSTVGLRLGEEARPPVGHFTTPEAPEVYAFLREAADRGLKSAVLE
VSSHALALKRVEGLTFRVGVFVNFYPDDHLDFHGTAEAYFRAKALLVERSDLAVLAHSLP
HFPRLAQRPHLSFGEGGEVYAEGLRETPEGLAFRLHTPWGSGEAFLPLLGAYNLENALAA
SAAALALGVGLEAVLEGLATFPGVPGRMEVVLKAPFRVVIDFAHTGKSLEAALKTLRPTT
PGRLLLVVGAAGERDPQRRVDIGRVAARLADKTFFTEEDHRGEDLFAILEAMAQAARAKG
GVYELVPDREEAILKAILEARPGDTVLLAGKGHETTLERGQVALPWNEREVALKALRARG
LL
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccttgaaggagctcttcaccctcttcgggaaggaggccccggaggtgcccgtc
aggggcctcaccctggactcgaggcgggtggagcccggcttcgtcttcgtggccgtaccc
ggggttcccctcccccaccggaagcccctggacgggcacgacttcgtccccgaggccctg
gcccgaggggcggtggccgtggtgggggaaaggcccctcgccctccccgtcccctacctc
caggtggccgacggccgccaagccctcgccctcctggcccggcgcttccacggggagccg
gaccgggagctcctcctcgtgggggtcacgggctccaagggcaagagcaccacggcaagc
ctcctccaccaccttctccagcgggcccagggcggaagcgccctcctctccaccgtgggc
ctccgtctgggggaggaggcccgcccccccgtgggccacttcaccaccccggaggccccc
gaggtctacgccttcctccgggaggcagcggaccgcggcctgaaaagcgccgtgctggag
gtctccagccacgccctcgccctgaagcgggtggagggcctcaccttccgggtgggggtc
ttcgtgaacttctatcccgacgaccacctggacttccacggcaccgccgaggcctacttc
cgggccaaggccctcctggtggagcggtcggacctcgccgtcctcgcccatagcctccct
cacttcccccggctcgcccaaaggccccacctgagcttcggggagggaggggaggtctat
gcggaggggcttcgggaaaccccggagggcctggccttccgcctccacaccccctggggg
tcaggggaggccttcttgcccctcctcggggcctacaacctggaaaacgccctcgccgca
agcgccgccgccctggccctgggggtgggcctcgaggcggtgctggagggcctcgccacc
ttccccggggtgccgggccggatggaggtggtcctcaaggcccctttccgcgtggtcatt
gacttcgcccacaccggcaagagcctggaggccgccctgaagaccctccgccccaccacc
ccggggaggctccttctggtggtgggggcggctggggagcgggacccccagcggcgcgtg
gacatcggccgggtggcggcccgcctcgccgataaaaccttcttcaccgaggaggaccac
cggggcgaggacctcttcgccatcctggaggccatggcccaggcggcccgggccaagggc
ggggtctacgagctcgtccccgaccgggaggaggccatcctcaaggccatcctcgaagcc
cgtcccggagacacggtcctgctcgccggcaaggggcacgaaaccaccctggagcggggc
caggtggccctgccctggaacgagcgggaggttgccctcaaagccctccgggcgcggggg
cttctctga

DBGET integrated database retrieval system