KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0380Help
Entry
Ththe16_0380      CDS       T01867                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:tts01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tts00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361865..363727
Genome map
AA seq 620 aa AA seqDB search
MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLRHVPKGADPLGPENAL
VFAPGILTGTPISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELKNAGLDALVVLGQAEAP
VYLHVEGGKVALHPAVHLWGKDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDL
AHFAGRGGLGAVMGAKRLKAVSARAHKETLPAYHDPGLLKELARRMAKERMDRAAGLVTM
GTVGTVKPFNLRGVLPSHNFLDGFLEGAEALDGTSLDALGIRIGRDTCYACAIRCKQVVK
IEGTGKYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKANTLCNQYGLDVIGVGVTIACA
MEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLGELLAQGAKRLAESLGHPELAM
HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPL
PVEDLSEAKIRMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVG
ERTLQLTRLFNLREGISPEEDRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEG
GVDPERLKALGLEEFQNALA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagggttatcacgaccgcgtggccttcgtggacctctccacgggaaaggtctgg
tacgaaagctttggcgaggccttctggcggcgctacctcggggggcgggccctcgccgcc
taccttctcctcaggcacgtgcccaagggggccgaccccctgggccccgagaacgccctc
gtcttcgcccccgggatcctcaccggaacccccatttccggctcggggcggaataccgtg
gccgcaaaaagccctctcaccggggggtacggagacgcggagggcggcggcttcttcggg
gcggagcttaagaacgcgggcctggacgccctggtggttttgggccaggcggaagccccc
gtctacctccacgtggaaggggggaaggtggcccttcaccccgcggtccacctctggggc
aaggaccccctggaggtggaggccctcatcaaggaggcccacggggggaacacccgcgtg
gcccagatcggcctcgccggggagaaccgggtcctcaccgccaacgtcatccacgacctg
gcccacttcgccggaagggggggcttgggggcggtcatgggggccaaaaggctcaaggcg
gtttccgcccgggcccacaaggagacccttcccgcctaccacgaccccggcctcctcaag
gagctcgcccggcgcatggccaaggagcgcatggaccgggcggcgggcctcgtcaccatg
ggcaccgtgggcacggtgaagccctttaacctccggggggtcctccccagccacaacttc
ctggatggctttttggagggggccgaggccctggacgggaccagcctggacgccctcggc
atccgcatcggccgggacacctgctacgcctgcgccatccgctgcaagcaggtggtgaag
attgagggcacgggcaagtacgacgtccgtcccgagtacggggggccggagtacgagggg
cttggggccttgggctccacctgcggggtcaccgacccctacgccgtgaccaaggccaac
accctctgcaaccagtacggcctggacgtgatcggggtgggggtgaccatcgcctgcgcc
atggaggcggtggagaagggctatttggacgacgagggcctgggcctgaggttcggcaac
ggggatgccctcatcgccgccatagagaagctggcgaggagggaggggaggcttggggag
cttctcgcccaaggggcgaagcgcctcgccgagagcctgggccacccggagctcgccatg
cacgtgaaggggcaggaggtgcccatgcacgacccccggtacaagcgggccctgggggtg
ggctacgcggtgagccccacgggggcggaccacaaccacaacctccacgacaccgccttc
gccaaggaggggagggccctgagggagctccgcttctacggggaggacttccagcccctg
cccgtagaggacctttccgaggccaagatccggatgctctggaccaagacccgggagcgg
gggttcgtgaacagcctggtgatgtgcgacttcgtcccctggaccccggaggagtggcgg
gaggccctctacgccgccacgggctggcggctttccccggaggagatgctggaggtgggg
gagagaacgctccagctcacccggcttttcaacctgcgggaggggatctccccggaggag
gaccggcttcccgagcgcttcttccagccctttcgcaaggggaaccccgaggcccgcttg
gaccccgaggccttccgggagggggtcagggcctaccggaggcttgcgggctgggaaggg
ggcgtggatccggaaaggctcaaggccttgggcctagaggagttccagaacgccctggcg
tag

DBGET integrated database retrieval system