KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0380Help
Entry
Ththe16_0380      CDS       T01867                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0380
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ththe16_0380
Enzymes [BR:tts01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Ththe16_0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361865..363727
Genome map
AA seq 620 aa AA seqDB search
MPKGYHDRVAFVDLSTGKVWYESFGEAFWRRYLGGRALAAYLLLRHVPKGADPLGPENAL
VFAPGILTGTPISGSGRNTVAAKSPLTGGYGDAEGGGFFGAELKNAGLDALVVLGQAEAP
VYLHVEGGKVALHPAVHLWGKDPLEVEALIKEAHGGNTRVAQIGLAGENRVLTANVIHDL
AHFAGRGGLGAVMGAKRLKAVSARAHKETLPAYHDPGLLKELARRMAKERMDRAAGLVTM
GTVGTVKPFNLRGVLPSHNFLDGFLEGAEALDGTSLDALGIRIGRDTCYACAIRCKQVVK
IEGTGKYDVRPEYGGPEYEGLGALGSTCGVTDPYAVTKANTLCNQYGLDVIGVGVTIACA
MEAVEKGYLDDEGLGLRFGNGDALIAAIEKLARREGRLGELLAQGAKRLAESLGHPELAM
HVKGQEVPMHDPRYKRALGVGYAVSPTGADHNHNLHDTAFAKEGRALRELRFYGEDFQPL
PVEDLSEAKIRMLWTKTRERGFVNSLVMCDFVPWTPEEWREALYAATGWRLSPEEMLEVG
ERTLQLTRLFNLREGISPEEDRLPERFFQPFRKGNPEARLDPEAFREGVRAYRRLAGWEG
GVDPERLKALGLEEFQNALA
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgcccaagggttatcacgaccgcgtggccttcgtggacctctccacgggaaaggtctgg
tacgaaagctttggcgaggccttctggcggcgctacctcggggggcgggccctcgccgcc
taccttctcctcaggcacgtgcccaagggggccgaccccctgggccccgagaacgccctc
gtcttcgcccccgggatcctcaccggaacccccatttccggctcggggcggaataccgtg
gccgcaaaaagccctctcaccggggggtacggagacgcggagggcggcggcttcttcggg
gcggagcttaagaacgcgggcctggacgccctggtggttttgggccaggcggaagccccc
gtctacctccacgtggaaggggggaaggtggcccttcaccccgcggtccacctctggggc
aaggaccccctggaggtggaggccctcatcaaggaggcccacggggggaacacccgcgtg
gcccagatcggcctcgccggggagaaccgggtcctcaccgccaacgtcatccacgacctg
gcccacttcgccggaagggggggcttgggggcggtcatgggggccaaaaggctcaaggcg
gtttccgcccgggcccacaaggagacccttcccgcctaccacgaccccggcctcctcaag
gagctcgcccggcgcatggccaaggagcgcatggaccgggcggcgggcctcgtcaccatg
ggcaccgtgggcacggtgaagccctttaacctccggggggtcctccccagccacaacttc
ctggatggctttttggagggggccgaggccctggacgggaccagcctggacgccctcggc
atccgcatcggccgggacacctgctacgcctgcgccatccgctgcaagcaggtggtgaag
attgagggcacgggcaagtacgacgtccgtcccgagtacggggggccggagtacgagggg
cttggggccttgggctccacctgcggggtcaccgacccctacgccgtgaccaaggccaac
accctctgcaaccagtacggcctggacgtgatcggggtgggggtgaccatcgcctgcgcc
atggaggcggtggagaagggctatttggacgacgagggcctgggcctgaggttcggcaac
ggggatgccctcatcgccgccatagagaagctggcgaggagggaggggaggcttggggag
cttctcgcccaaggggcgaagcgcctcgccgagagcctgggccacccggagctcgccatg
cacgtgaaggggcaggaggtgcccatgcacgacccccggtacaagcgggccctgggggtg
ggctacgcggtgagccccacgggggcggaccacaaccacaacctccacgacaccgccttc
gccaaggaggggagggccctgagggagctccgcttctacggggaggacttccagcccctg
cccgtagaggacctttccgaggccaagatccggatgctctggaccaagacccgggagcgg
gggttcgtgaacagcctggtgatgtgcgacttcgtcccctggaccccggaggagtggcgg
gaggccctctacgccgccacgggctggcggctttccccggaggagatgctggaggtgggg
gagagaacgctccagctcacccggcttttcaacctgcgggaggggatctccccggaggag
gaccggcttcccgagcgcttcttccagccctttcgcaaggggaaccccgaggcccgcttg
gaccccgaggccttccgggagggggtcagggcctaccggaggcttgcgggctgggaaggg
ggcgtggatccggaaaggctcaaggccttgggcctagaggagttccagaacgccctggcg
tag

DBGET integrated database retrieval system