KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0431Help
Entry
Ththe16_0431      CDS       T01867                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Ththe16_0431
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Ththe16_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(406893..407813)
Genome map
AA seq 306 aa AA seqDB search
MRFFVLGDVSVDLLFFLERIPEPGEEVPSRRALMKPGGAGGTLAAQLASLGHRVFLAGRV
GKDPFAELALSRVREAGVDLRYLQEDLEHTTSSVLILVVPGGERAMVSAEGASRYLDPAL
FKPRFLDQVDAVVLSAYALVGGPSRSYAAEVLEAARRRELPVFADLGAGAVRAAGKELLK
HLRGVSWLLMNERELKTLTGASSISQGVARLRQEGFQRLAVKVGAMGSIVVTPEGEELLE
PFPIEDIVDSTGAGDAYTAAFAHAILEGKSPVEAGRLANLAGALAATAIGAQGRLVTLED
LKVAAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcttcgtgctgggagacgtttccgtggatctgcttttcttcctggagcgcatc
cccgagccaggggaggaggtgccctcgaggcgggccttgatgaagccaggcggggccggg
ggaaccttggcggcccagctcgcaagcctaggccaccgggtcttcctggcgggccgggtg
ggaaaagatcccttcgccgagctcgccctaagccgggtgcgggaggcgggggtggacctc
cggtacctccaggaggatctggagcacaccacaagctccgtcctcatcctggtggtgccc
gggggggagagggccatggtgagcgccgagggggcgagccgctacctggatcccgccctc
ttcaagccccgcttcctggaccaggtggacgccgtggtcctctccgcctacgccctggtg
ggcgggccttcccggagctacgccgccgaggtcctggaggcggcgcgaaggcgggagctt
cccgttttcgccgacctcggggccggggcggtgcgggccgcaggaaaggaacttctcaag
caccttcggggggtgagctggctcctcatgaacgagagggagctcaaaaccctcaccggt
gcctcctccatctcccagggggtggcaaggctccgccaggaggggttccaacgcctcgcc
gtcaaggtgggggccatgggctccatcgtggtcaccccggaaggggaggagcttctagag
cccttccccatagaggacatcgtggactccaccggggccggggacgcctacaccgccgcc
ttcgcccacgccatcctggagggcaaaagccccgtggaggcgggccggcttgccaacctg
gcgggcgctttagccgccaccgccatcggagcccagggacggctcgtcaccctagaggac
ctcaaagtagcggcgggctag

DBGET integrated database retrieval system