KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0491Help
Entry
Ththe16_0491      CDS       T01867                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00260  Glycine, serine and threonine metabolism
tts00750  Vitamin B6 metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01230  Biosynthesis of amino acids
Module
tts_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ththe16_0491
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ththe16_0491
Enzymes [BR:tts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ththe16_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: AEG32919
UniProt: F6DEG4
Structure
PDB: 

Jmol
Position
462839..463894
Genome map
AA seq 351 aa AA seqDB search
MRPPLIERYRNLLPVSEKTPVISLLEGSTPLIPLKGPEEARKKGIRLYAKYEGLNPTGSF
KDRGMTLAVSKAVEGGAQAIACASTGNTAASAAAYAARAGILAIVVLPAGYVALGKVAQS
LVHGARIVQVEGNFDDALRLTQRLTEAFPVALVNSVNPHRLQGQKTLAFEVVDELGDAPH
YHALPVGNAGNITAHWMGYKAYHALGKARRLPRMLGFQAAGAAPLVLGRPVERPETLATA
IRIGNPASWEGAIRAKEESGGVIEAVTDEEILFAYRYLAREEGIFCEPASAAAMAGVFKL
LREGRLEPESTVVLTLTGHGLKDPATAERVAELPPPVPARLEAVAAAAGLL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcggccgcccctaatagagcgctaccggaacctcctcccggtctcggagaagacgccg
gtgataagcctcctggagggctccaccccccttatcccccttaagggcccggaggaggcg
aggaagaagggcatccgcctctacgccaagtacgagggcttaaaccccacgggaagcttc
aaggaccgggggatgaccctcgccgtctccaaggcggtggaagggggggcccaggccatc
gcctgcgccagcaccgggaacaccgccgcctccgccgccgcctacgccgcaagggccggg
attttggccatcgtggtcctccccgcagggtacgtggccttgggcaaagtggcccagagc
ctggtgcacggggcgaggatcgtccaggtggaggggaactttgacgacgccctgcgcctc
acccaaaggctcacggaggccttccccgtggccctggtgaactccgtgaacccccaccgc
ctacagggccagaagaccctggcctttgaggtggtggacgagctcggcgacgccccccac
taccacgcccttcccgtggggaacgcggggaacatcaccgcccactggatgggctacaag
gcgtaccacgccctgggcaaggccaggaggcttcccagaatgctcggcttccaggcggcg
ggggcggcccccttggtcctgggccgcccggtggagcgccccgagaccctggccaccgcc
atccgcattggcaacccggcgagctgggagggggccatccgggccaaggaggagtcgggg
ggggtcatagaggcggtgacggacgaggagatcctcttcgcctaccgctacctggcccgg
gaggaagggatcttctgcgagcccgcaagcgccgccgccatggcgggggtcttcaagctt
ttgcgggagggtaggcttgagccggagagcaccgtggtcctcaccctcacgggccacggc
ctcaaagacccggccaccgccgagagggtggccgagcttcccccgcccgtgcccgcgcgc
ctcgaggcggtggccgcggccgcggggcttttgtga

DBGET integrated database retrieval system