KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0505Help
Entry
Ththe16_0505      CDS       T01867                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0505
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ththe16_0505
   00630 Glyoxylate and dicarboxylate metabolism
    Ththe16_0505
Enzymes [BR:tts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ththe16_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(474025..475587)
Genome map
AA seq 520 aa AA seqDB search
MKGVEIRKDHPLLKEVLTEEALRFVVALHREFNPVRKALLERRQALWERYKAGEKPDFLQ
ETAFVRGGDWKVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIRGQKNLYDAVRRQIDFVSPEGKEYKLKEKTATLVVRPRGWHLVEKHVYVDGEPISASL
FDFGLYFFHNAHELLKRGSGPYFYLPKMESHLEARLWNEVFNFAQDYLKIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHEAHAIGGMAAFIPSRKDPQVNERAFQQVRADKEREASQGFDGTWVAH
PDLVPVAQEVFDRYLGDKPHQKHVKREDVQVSAQDLLNFEVPGGKVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHREAKLEDGRTITPELYQKVKEEEL
AKLGGREVGRYKEAEEILDKLVLSEEFIEFLTLVAYDYID
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggagatccgcaaagaccaccccctcctcaaggaggtcctgacggaggag
gccctgaggttcgtggtggccctgcaccgggagttcaacccggtgcgcaaggccctcctg
gagcggcgtcaagcgctttgggagcggtacaaggccggggagaagccggacttcctccaa
gagaccgccttcgtccggggcggggactggaaggtggcggaggccccgcctgacctcctg
gaccgccgggtggagatcacgggccccgtggaccgcaagatgatcatcaacgccttgaac
tcgggggccaaggtcttcatggcggactttgaggacgccctctcccccacctgggacaac
gtcatccggggccagaagaacctctatgacgccgtgcgccgccagattgacttcgtctcc
cccgagggcaaggagtacaagctcaaggaaaagacggccaccctggtggtgcgcccaagg
ggctggcaccttgtggaaaagcacgtctacgtggacggggagcccatctcggcgagcctc
tttgacttcggcctctacttcttccacaacgcccacgagctcttaaagcggggaagcggg
ccctacttctacctgcccaagatggaaagccacctcgaggcccgcctctggaacgaggtc
ttcaacttcgcccaggactacctgaagatcccccggggcaccatccgggccacggtcctc
attgagaccatcctggcggcctttgagatggaggagatcctctacgagctcaaggagcac
gccgccgggctcaacgccggccgctgggactatatcttcagctgcatcaaaaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtgaccatgaccgtgcccttcatgaaa
gcctacaccgagcttttggtgaagtcctgccacatccacgaggcccacgccatcggcggg
atggcggccttcatcccaagccgcaaggacccccaggtgaacgagcgcgccttccagcag
gtgcgcgcggacaaggaaagggaggcctcccagggctttgacggcacctgggtggcccac
cccgacctggtgcccgtggctcaagaggtctttgaccgctacctgggggacaagccccac
cagaagcacgtgaagcgggaagacgtccaggtgagcgcccaagacctcctgaactttgag
gtccccggcggcaaggtgacggaggcgggcctcaggaacaacatctccgtggccctgcag
tacctgaaccagtggcttttgggtaacggggccgccgccatcttcaacctgatggaggac
gccgccaccgccgagatcagccgggctcagctttggcagtgggtccaccgggaggccaag
ctggaagacggccgcaccatcacccctgagctttaccaaaaggtcaaggaggaagagctc
gccaagcttgggggtagggaggtgggccgctacaaggaggcggaggagatcctggacaag
ctcgtcctctccgaggagttcattgagttcctgaccctggtggcctacgactacattgac
tag

DBGET integrated database retrieval system