KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0505Help
Entry
Ththe16_0505      CDS       T01867                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00620  Pyruvate metabolism
tts00630  Glyoxylate and dicarboxylate metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01200  Carbon metabolism
Module
tts_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ththe16_0505
   00630 Glyoxylate and dicarboxylate metabolism
    Ththe16_0505
Enzymes [BR:tts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Ththe16_0505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI LIX1
Motif
Other DBs
NCBI-ProteinID: AEG32933
UniProt: F6DEH8
Position
complement(474025..475587)
Genome map
AA seq 520 aa AA seqDB search
MKGVEIRKDHPLLKEVLTEEALRFVVALHREFNPVRKALLERRQALWERYKAGEKPDFLQ
ETAFVRGGDWKVAEAPPDLLDRRVEITGPVDRKMIINALNSGAKVFMADFEDALSPTWDN
VIRGQKNLYDAVRRQIDFVSPEGKEYKLKEKTATLVVRPRGWHLVEKHVYVDGEPISASL
FDFGLYFFHNAHELLKRGSGPYFYLPKMESHLEARLWNEVFNFAQDYLKIPRGTIRATVL
IETILAAFEMEEILYELKEHAAGLNAGRWDYIFSCIKKFATTAPIFPDRAQVTMTVPFMK
AYTELLVKSCHIHEAHAIGGMAAFIPSRKDPQVNERAFQQVRADKEREASQGFDGTWVAH
PDLVPVAQEVFDRYLGDKPHQKHVKREDVQVSAQDLLNFEVPGGKVTEAGLRNNISVALQ
YLNQWLLGNGAAAIFNLMEDAATAEISRAQLWQWVHREAKLEDGRTITPELYQKVKEEEL
AKLGGREVGRYKEAEEILDKLVLSEEFIEFLTLVAYDYID
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagggcgtggagatccgcaaagaccaccccctcctcaaggaggtcctgacggaggag
gccctgaggttcgtggtggccctgcaccgggagttcaacccggtgcgcaaggccctcctg
gagcggcgtcaagcgctttgggagcggtacaaggccggggagaagccggacttcctccaa
gagaccgccttcgtccggggcggggactggaaggtggcggaggccccgcctgacctcctg
gaccgccgggtggagatcacgggccccgtggaccgcaagatgatcatcaacgccttgaac
tcgggggccaaggtcttcatggcggactttgaggacgccctctcccccacctgggacaac
gtcatccggggccagaagaacctctatgacgccgtgcgccgccagattgacttcgtctcc
cccgagggcaaggagtacaagctcaaggaaaagacggccaccctggtggtgcgcccaagg
ggctggcaccttgtggaaaagcacgtctacgtggacggggagcccatctcggcgagcctc
tttgacttcggcctctacttcttccacaacgcccacgagctcttaaagcggggaagcggg
ccctacttctacctgcccaagatggaaagccacctcgaggcccgcctctggaacgaggtc
ttcaacttcgcccaggactacctgaagatcccccggggcaccatccgggccacggtcctc
attgagaccatcctggcggcctttgagatggaggagatcctctacgagctcaaggagcac
gccgccgggctcaacgccggccgctgggactatatcttcagctgcatcaaaaagttcgcc
accaccgcccccatcttccccgaccgggcccaggtgaccatgaccgtgcccttcatgaaa
gcctacaccgagcttttggtgaagtcctgccacatccacgaggcccacgccatcggcggg
atggcggccttcatcccaagccgcaaggacccccaggtgaacgagcgcgccttccagcag
gtgcgcgcggacaaggaaagggaggcctcccagggctttgacggcacctgggtggcccac
cccgacctggtgcccgtggctcaagaggtctttgaccgctacctgggggacaagccccac
cagaagcacgtgaagcgggaagacgtccaggtgagcgcccaagacctcctgaactttgag
gtccccggcggcaaggtgacggaggcgggcctcaggaacaacatctccgtggccctgcag
tacctgaaccagtggcttttgggtaacggggccgccgccatcttcaacctgatggaggac
gccgccaccgccgagatcagccgggctcagctttggcagtgggtccaccgggaggccaag
ctggaagacggccgcaccatcacccctgagctttaccaaaaggtcaaggaggaagagctc
gccaagcttgggggtagggaggtgggccgctacaaggaggcggaggagatcctggacaag
ctcgtcctctccgaggagttcattgagttcctgaccctggtggcctacgactacattgac
tag

DBGET integrated database retrieval system