KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0537Help
Entry
Ththe16_0537      CDS       T01867                                 

Definition
(RefSeq) succinyl-CoA ligase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0537
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ththe16_0537
   00640 Propanoate metabolism
    Ththe16_0537
   00660 C5-Branched dibasic acid metabolism
    Ththe16_0537
Enzymes [BR:tts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Ththe16_0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(503876..505051)
Genome map
AA seq 391 aa AA seqDB search
MPLTGVARQGRWVLNLHEYQAKEILARYGVPVPPGKVAYTPEEAKRIAEEFGKRVVIKAQ
VHVGGRGKAGGVKLADTPQEAYEKAQAILGMNIKGLTVKKVLVAEAVDIAKEYYAGLILD
RAKKRVVLMLSKEGGVDIEEVAAERPEAIHKFWIDPHKGFRPFEAREMVKRAGLEGNLNK
LAQVLVALYRAYEGVDASIAEINPLVVTTDGGIVAADAKIVLDDNALFRHPDLAELREVE
AEHPLEVEASNYGFAYVKLDGNIGIIGNGAGLVMYTLDLVNRVGGKPANFLDIGGGAKAD
VVYNALKVVLKDPDVKGVFINIFGGITRADEVAKGVIRALEEGLLTKPVVMRVAGTAEEE
AKKLLEGKPVYMYPTSIEAAKAIVAMVGGAA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcccttgaccggggtcgcccggcaagggaggtgggtcttgaacctgcacgagtatcaa
gcgaaggagatcctggcccgctatggggtgcccgtgccgccgggaaaggtggcctacacc
cccgaggaggccaaacggatcgccgaagagttcggcaagcgggtggtcatcaaggcccag
gtgcacgtgggagggagaggaaaggcggggggcgtcaagctcgccgacaccccccaggag
gcctacgagaaggcccaggccatcctgggcatgaacatcaagggcctcaccgtgaagaag
gtcctggtggccgaggcggtggacatcgccaaggagtactacgcgggcctcatcctggac
cgggccaagaagcgggtggtcctcatgctctccaaggaggggggcgtggacattgaggag
gtggccgcggagcgccccgaggccatccacaagttctggatagacccccacaaggggttc
cgcccctttgaggcccgggagatggtgaagcgggcggggctggagggcaacctcaacaag
ctcgcccaggtcctggtggccctctaccgggcctacgagggcgtggacgcctccatcgcc
gagatcaaccccctggtggtgaccacggacggcgggatcgtcgccgccgacgccaagatc
gtcctggacgacaacgccctcttccgccaccccgacctggccgagctcagggaggtggag
gccgaacaccccttggaggtggaggccagcaactacggcttcgcctacgtgaagcttgat
ggcaacatcggcatcatcggcaacggggcgggcctcgtgatgtacaccctggatctggtg
aaccgggtagggggcaagcccgccaacttcctggacatcggcggcggggccaaggcggac
gtggtctacaacgccctcaaggtggtcctcaaggaccccgacgtcaagggggtcttcatc
aacatcttcggcggcatcacccgggcggacgaggtggccaagggggtgatccgcgccctg
gaggagggcctcctcaccaagcccgtggtgatgcgggtggcgggcaccgccgaggaggag
gccaagaagcttttggaggggaagcccgtctacatgtaccccacgtccattgaggcggcc
aaggccatcgtggccatggtgggaggtgcggcgtga

DBGET integrated database retrieval system