KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0638Help
Entry
Ththe16_0638      CDS       T01867                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tts00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607900..609294
Genome map
AA seq 464 aa AA seqDB search
MKAKTLGELMRTYPLEKLRRTVKDEARENLREKLRRGERLFPGIHGYEDTVIPALVQAIL
AKQNFILLGTRGQAKSRILRSLTSLLDEEVPALATELRDNPLHPISPEGKRLLEEAGDDA
PIVWLSREDRYVEKLATPDTTVADLLGDMDPIKAARRGTGMADLESIHYGLLPRANRGIF
AVNELADLAPKVQVALFNILEEGDVQIRGYPLRLPLDVWLVFTANPQDYTARGRIVTPLK
DRIGSEIRTHYPRSLEEGARISAQEAYVPEGVLVPEWVRLSVEAVAFVAREDRRVDQTAG
VSQRLAISLLEVVAASAERRALLHGGRPVARPLDLYQGLPAITGKLELEYEGELQGAERV
AREIVQRAFGLVLPRYRLRTEPIVAHFEEGNLLTLPEGDVEEALKAMAGVPGLLEAARAL
AEGEAPEVLLSAGEFVLEGLVGRRKLSRGEASYQAAERPRSYGN
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggccaagaccctaggcgaactcatgcgcacctaccccctggagaagctccgccgc
accgtgaaggacgaggccagggagaacctccgggagaagctcaggcgtggggagaggctc
ttccccggcatccacggctacgaggacacggtgatccccgccctggtccaggccatcctc
gccaagcagaacttcatcctcctcggcacccggggccaggcgaaaagccggatcctgcgg
agcctcacgagcctcctggacgaggaggttcccgccctcgccacggagcttcgcgacaac
cccctccaccccatctcccccgagggaaagcgcctcctggaggaggctggggacgacgcc
cccatcgtctggctttcccgggaggaccggtacgtggagaagctcgccacccccgacacc
accgtggccgacctcctcggggacatggaccccatcaaggcggccaggcggggcacgggg
atggcggacctggagagcatccactacggcctcctgccccgggcgaaccgggggatcttc
gccgtgaacgagctcgccgacctcgcccccaaggtgcaggtggccctcttcaacatcctc
gaggagggggacgtccagatccggggctaccccctccggcttcccctggacgtctggctc
gtcttcaccgccaacccccaggactacaccgcccgggggcgcatcgtgacccccctcaag
gaccggatcgggagcgagatccgcacccactaccctcgctccctggaggagggggcccgg
atcagcgcccaggaggcctacgtgccggagggggtcctggtcccggagtgggtgaggctt
tccgtggaggccgtggccttcgtcgcccgggaggaccgccgcgtggaccagacggcgggg
gtctcccagcgcctcgccatcagccttttggaggtggtggcggcaagcgccgagcgccgc
gccctcctccacgggggaaggcccgtggcgaggcctttggacctctaccaggggcttccc
gccatcaccgggaagctggagttggagtacgaaggggagctccagggggcggagagggtg
gcgcgggagatcgtgcagcgggccttcggcctggtcctcccccgctaccgcctgaggacc
gagcccatcgtggcccactttgaggagggaaacctcctcaccctgcccgagggggacgtg
gaggaggcccttaaggccatggccggggtcccggggcttctggaggcggcaagggccctg
gccgagggggaagcccctgaggttttgctgtccgccggggagttcgtcctcgagggcctg
gtggggcggcggaagctttcccggggcgaggcgagctaccaggcggcggagcgcccgagg
agctatggcaactag

DBGET integrated database retrieval system