KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0674Help
Entry
Ththe16_0674      CDS       T01867                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ththe16_0674
Enzymes [BR:tts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ththe16_0674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(637965..638726)
Genome map
AA seq 253 aa AA seqDB search
MRIAYAGLRRKEEFKALAEKLGFTPLLFPVQATEKVPVPEYRDHLRALAQGVDLFVATTG
VGVKDLLEAGKALGLDLRKPLKGAFRLARGAKAARTLRELGLPPHAVGDGTSKSLLPLLP
QGPGKAALQLYGKPLPLLENALAERGYRVLPLMPYRHLPDLEGILRLEEALLGGEVDALA
FVAAIQVEFLFEGAKDPKALREALNTRVKALAVGRVTADALREWGVSPFYVDETERLGSM
LQGFRKALQKEVA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcctacgccggcctaaggcgcaaagaggagtttaaggccctggcggaaaag
ctcggcttcacccccctcctcttccccgtccaggccacagaaaaggtccccgtccccgag
taccgggaccacctgcgggcgcttgcccaaggggtggacctctttgtggctaccaccggg
gtgggggtaaaagacctcctcgaggcgggaaaggccctgggcctagaccttagaaagccc
ttgaaaggggccttccgcttggcccggggcgccaaggccgcccgcaccttacgggagctc
ggccttcccccccacgccgtgggggacgggacctctaagagcctcctccccctcctcccc
cagggccccggcaaggccgccttgcagctttacggcaagccccttccccttctggaaaac
gccctggcggaaaggggctaccgggtccttcccctcatgccctaccgccacctcccggac
ctcgaggggatcctccgcctcgaggaggccctccttgggggtgaggtggacgccctcgcc
ttcgtggccgccattcaggtggagttcctctttgagggggcgaaagaccccaaggccctg
agggaagccctcaacacccgggtcaaggccctcgccgtgggccgggtcaccgccgacgcc
ctacgggagtggggcgtaagccccttctacgtggacgaaaccgagcgcctcgggagcatg
ctccagggcttccgaaaagccctgcaaaaggaggtggcatga

DBGET integrated database retrieval system