KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0674Help
Entry
Ththe16_0674      CDS       T01867                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tts00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(637965..638726)
Genome map
AA seq 253 aa AA seqDB search
MRIAYAGLRRKEEFKALAEKLGFTPLLFPVQATEKVPVPEYRDHLRALAQGVDLFVATTG
VGVKDLLEAGKALGLDLRKPLKGAFRLARGAKAARTLRELGLPPHAVGDGTSKSLLPLLP
QGPGKAALQLYGKPLPLLENALAERGYRVLPLMPYRHLPDLEGILRLEEALLGGEVDALA
FVAAIQVEFLFEGAKDPKALREALNTRVKALAVGRVTADALREWGVSPFYVDETERLGSM
LQGFRKALQKEVA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgcctacgccggcctaaggcgcaaagaggagtttaaggccctggcggaaaag
ctcggcttcacccccctcctcttccccgtccaggccacagaaaaggtccccgtccccgag
taccgggaccacctgcgggcgcttgcccaaggggtggacctctttgtggctaccaccggg
gtgggggtaaaagacctcctcgaggcgggaaaggccctgggcctagaccttagaaagccc
ttgaaaggggccttccgcttggcccggggcgccaaggccgcccgcaccttacgggagctc
ggccttcccccccacgccgtgggggacgggacctctaagagcctcctccccctcctcccc
cagggccccggcaaggccgccttgcagctttacggcaagccccttccccttctggaaaac
gccctggcggaaaggggctaccgggtccttcccctcatgccctaccgccacctcccggac
ctcgaggggatcctccgcctcgaggaggccctccttgggggtgaggtggacgccctcgcc
ttcgtggccgccattcaggtggagttcctctttgagggggcgaaagaccccaaggccctg
agggaagccctcaacacccgggtcaaggccctcgccgtgggccgggtcaccgccgacgcc
ctacgggagtggggcgtaagccccttctacgtggacgaaaccgagcgcctcgggagcatg
ctccagggcttccgaaaagccctgcaaaaggaggtggcatga

DBGET integrated database retrieval system