KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0694Help
Entry
Ththe16_0694      CDS       T01867                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tts00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:tts00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(657024..657779)
Genome map
AA seq 251 aa AA seqDB search
MGAFSGRTVLVTGAGSGIGLAIARAFAREGARVLVHDVRDASRLAEELGGVYLQADLADP
KEVEALGKEAAAMGVDVLVNNAGFQHIAPVEEFPLEVWQRMLQVMLTAPFQLTQALLPGM
KRRGWGRILNIASIHGLVASPYKSAYISAKHGLLGLTKTVALEAGPHGVTVNAIAPAYVR
TPLVEGQIQDQAKTLGIPPEEVAEKVFLAQAAIKRLIAPEEVAELALFLASEKASAITGA
VFPIDLGWTAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgggagcgttttcgggaaggacggtcctcgtcaccggcgcgggaagcggcatcggcctg
gccatcgccagggccttcgcccgggagggggcgagggtcttggtccacgacgtgcgggac
gcctcgaggctcgccgaggagctcggtggggtctacctccaggcggacctcgccgacccc
aaagaggtggaggccctgggcaaggaggcggcggccatgggcgtggacgtcctggtgaac
aacgccggcttccagcacatcgcccccgtggaggagttccccctggaggtctggcaacgg
atgctccaggtgatgctcaccgcccccttccagctcacccaagccctcctccccgggatg
aagcgaaggggctggggccggatcctgaacatcgccagcatccacggcctggtggcgagc
ccctataagagcgcctacatctcggccaagcacggcctcctcggcctcaccaagacggtg
gccctcgaggccgggccccatggcgtcaccgtaaacgccatcgcccccgcctacgtccgc
acccccctggtggagggccagatccaggaccaggccaagaccctggggatcccccccgag
gaggtggcggagaaggtcttcctggcccaggcggccatcaagcgcctcatagcgcccgaa
gaggtggccgagctcgccctcttcctggcctcggagaaggccagcgccatcaccggggcc
gtcttccccatagacctgggctggacggcccgctag

DBGET integrated database retrieval system