KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0733Help
Entry
Ththe16_0733      CDS       T01867                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tts01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:tts00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
693856..695094
Genome map
AA seq 412 aa AA seqDB search
MIYAAEEVRARFARRGLSFDPTVEEIVRGILEAVREEGDEALDRFSRDLDGYPVEEVPKR
AWREAYEDLDEDLRDALETARERIEAFYREEARGGFLWAEGGGVLAQLVRPLERVGVYVP
GGSAPLLSTLLMTVVPAKVAGVREVIVASPPKVHPGVLAAAWVAGADRLFAMGGAQAIAA
LAYGTGRVPRVDKIVGPGNRYVVAAKRLVYGTVGIDGLAGPTETMIIADGSASPRLLAAD
LLAQAEHGPDSEPWLLSPDRALLERVEAELSRQLQDLPRAEVARQALEKGGLVLTKDLEE
AFALANLYAPEHLSLALSDPLPWLEKVQNAGGVFLGEGSPEALGDYIAGPSHVMPTSGTA
RFQGGLAVRDFLKVIPVVGLSEGAARELAKKGALLARAEGLEGHARSLDLRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgccgccgaggaggtgcgggcccgcttcgcccgccggggcctctcctttgac
cccacggtggaggagatcgtgcggggcatcctggaggcggtccgggaggaaggggacgag
gccctggaccggttcagccgggacctggacggctacccggtggaggaggtccccaagcgg
gcctggcgggaggcctacgaggacttggacgaggacctcagggacgccctggagacggcc
cgggagcgcatagaggccttctaccgcgaggaggcccggggcggcttcctctgggccgag
gggggcggggtgctggcccagctcgtccgccccctggagcgggtgggggtctacgtcccc
gggggaagcgctcccctcctctccaccctcctcatgaccgtggtcccggccaaggtggcg
ggggtgcgggaggtgatcgtggcgagcccccccaaggtccaccccggggtcctggccgcc
gcctgggtggcgggggccgaccgcctcttcgccatgggcggggcccaggccatcgccgcc
ttggcctacggcacggggcgcgtcccccgggtggacaagatcgtggggccggggaaccgc
tacgtggtggcggcgaagcggctcgtctacggcaccgtgggcattgacggcctcgccggc
cccacggagaccatgatcatcgccgacggctccgcctcccccaggctcctcgccgccgac
ctcctggcccaggcggagcacggccccgactccgagccctggctcctctccccggaccgg
gccctgttggaacgggtggaggccgagctttcccggcagctccaggacctcccccgggcc
gaggtggcccgtcaggccctggagaagggcgggctcgtcctcaccaaggacctggaggag
gccttcgccctcgccaacctctacgcccccgagcacctctccctcgccctctcggacccc
cttccctggctggagaaggtgcagaacgccgggggggtcttcctgggggaggggagcccc
gaggccttgggcgactacatcgccgggcccagccacgtcatgcccacctcggggacggcc
cgcttccagggggggttggcggtgcgggacttcctgaaggtgatcccggtggtgggcctt
tccgagggcgcggcccgggagctcgccaagaagggggcgcttttggcccgggcggagggc
ctcgagggccacgcccgctccctggacctcaggcgatga

DBGET integrated database retrieval system