KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0784Help
Entry
Ththe16_0784      CDS       T01867                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Ththe16_0784
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Ththe16_0784
Enzymes [BR:tts01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Ththe16_0784
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(747358..748263)
Genome map
AA seq 301 aa AA seqDB search
MRHLLDFQGWTRPEVESLLDTARVMREVLERPVKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFAAQTSSLQKGESYKDTLLTLEAMGVDAYVIRADSAGVPHQATRWVKG
AVINGGDGRRAHPTQALLDAYTLLEALGTLEGKKVAIVGDILHSRVARSNAELLPLLGAQ
VFCAGPPSLLPQSLPGAHLTPRLEEALEEADAVMVLRLQKERMEAGLVHLEDYVARYQVT
EKRLALAKPQAPLLHPGPMNRDVELEGTLADSARSLVNRQVQNGVAVRMAVLYHLLVGKG
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggactaggcctgaggtggaaagcctcctggac
accgcccgggtgatgcgggaggtcctggagcggcccgtaaagaaggttcccgccctccag
ggcttcaccgtggccacggtcttctttgagccctccacaaggacgcggatctcctttgag
ctcgccgcaaggcgcatgtcggcggacgtggtctccttcgccgcccagacgagcagcctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacgtcatccgggccgacagcgccggcgtaccccaccaggccacccgctgggtcaagggc
gccgtcatcaacgggggggacgggcgccgggcccaccccacccaggccctcctggacgcc
tacaccctcctcgaggccctgggcaccctggagggcaagaaggtcgccatcgtgggggac
atcctccactcccgggtggcccgttccaacgccgagctccttcccctcctcggggcccag
gtcttctgcgccggccccccgagcctcctcccccaaagcctccccggagcccacctcacc
ccccgtctggaggaggccctggaggaggcggacgccgtcatggtcctcaggctccagaag
gagcggatggaggcggggctcgtccacctggaggactacgtcgcccgctaccaggtgacc
gagaagaggctcgccctggccaagccccaagcccccctcctccaccccggccccatgaac
cgggacgtggagctggaggggaccttggcggactcggcgaggagcctggtgaaccgacag
gtgcaaaacggggtggcggtgcgcatggcggtgctctaccaccttttggtgggaaaaggg
aggtga

DBGET integrated database retrieval system