KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0784Help
Entry
Ththe16_0784      CDS       T01867                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tts00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tts00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(747358..748263)
Genome map
AA seq 301 aa AA seqDB search
MRHLLDFQGWTRPEVESLLDTARVMREVLERPVKKVPALQGFTVATVFFEPSTRTRISFE
LAARRMSADVVSFAAQTSSLQKGESYKDTLLTLEAMGVDAYVIRADSAGVPHQATRWVKG
AVINGGDGRRAHPTQALLDAYTLLEALGTLEGKKVAIVGDILHSRVARSNAELLPLLGAQ
VFCAGPPSLLPQSLPGAHLTPRLEEALEEADAVMVLRLQKERMEAGLVHLEDYVARYQVT
EKRLALAKPQAPLLHPGPMNRDVELEGTLADSARSLVNRQVQNGVAVRMAVLYHLLVGKG
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacctcctggacttccagggctggactaggcctgaggtggaaagcctcctggac
accgcccgggtgatgcgggaggtcctggagcggcccgtaaagaaggttcccgccctccag
ggcttcaccgtggccacggtcttctttgagccctccacaaggacgcggatctcctttgag
ctcgccgcaaggcgcatgtcggcggacgtggtctccttcgccgcccagacgagcagcctc
cagaagggggaaagctacaaggacaccctcctcaccctcgaggccatgggggtggacgcc
tacgtcatccgggccgacagcgccggcgtaccccaccaggccacccgctgggtcaagggc
gccgtcatcaacgggggggacgggcgccgggcccaccccacccaggccctcctggacgcc
tacaccctcctcgaggccctgggcaccctggagggcaagaaggtcgccatcgtgggggac
atcctccactcccgggtggcccgttccaacgccgagctccttcccctcctcggggcccag
gtcttctgcgccggccccccgagcctcctcccccaaagcctccccggagcccacctcacc
ccccgtctggaggaggccctggaggaggcggacgccgtcatggtcctcaggctccagaag
gagcggatggaggcggggctcgtccacctggaggactacgtcgcccgctaccaggtgacc
gagaagaggctcgccctggccaagccccaagcccccctcctccaccccggccccatgaac
cgggacgtggagctggaggggaccttggcggactcggcgaggagcctggtgaaccgacag
gtgcaaaacggggtggcggtgcgcatggcggtgctctaccaccttttggtgggaaaaggg
aggtga

DBGET integrated database retrieval system