KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0861Help
Entry
Ththe16_0861      CDS       T01867                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00900  Terpenoid backbone biosynthesis
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01130  Biosynthesis of antibiotics
Module
tts_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ththe16_0861
Enzymes [BR:tts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Ththe16_0861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Epimerase
Motif
Other DBs
NCBI-ProteinID: AEG33278
UniProt: F6DGC0
Position
complement(819168..820271)
Genome map
AA seq 367 aa AA seqDB search
MKRVVVLGSTGSIGKQALEVCRLRGYEVVGLAAGKNLEALSRQIVLWKPRLVAAEESLHK
ELKARFPGLRLATAEEVAALEAEVAVAAIPGLAGLAPTRAAVRTGKRVALANKEAMVAAG
PLLWQEAEAHGAEILPVDSEHSALFQALLGERREDVAELILTASGGPFLKEPEDLSQVTP
EMALNHPRWRMGPKVTVDSATLFNKGLEVLEAKELFRFPLERIKVLIHPQAYVHGLVRFL
DGSLKAQLGPTDMRLFIQYALTYPERAETPLKDLPIPGVLEFLEPDLKRFPALAVAYEAG
RRGGLAQVAVSAADEVAVEAFLQGKIPFPRIPEILARVLEATPAEPLTWESLFAVDAWAR
EEAKRWA
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggtcgtcgtcctcggatccacgggttccatcggaaagcaggccctcgaggtc
tgccgcctgaggggttacgaggtggtgggcctcgccgccgggaaaaacctcgaggccctc
tcccggcagatcgtcctctggaagccccgcctggtggcggcggaggaaagcctccacaag
gagctcaaggcccgcttccccgggcttaggctcgccacggccgaggaggtggccgccctg
gaggcggaggtggccgtggccgccatccctggtctcgccgggctcgcccctacccgggcg
gcggtgcggaccgggaaacgggtggccctcgccaacaaggaggccatggtggcggcgggg
cccctcctctggcaggaggcggaggcccacggggccgagatcctccccgtggactcggag
cactccgccctcttccaggccctcctcggggagaggcgggaggacgtggccgagctcatc
ctcacggcaagcggcgggcctttcctcaaggagcctgaggacctctctcaagtgacccca
gagatggccttaaaccacccccgctggcggatgggccccaaggtcaccgtggactccgcc
accctcttcaacaaaggcctcgaggtcctggaggccaaagagctctttcgtttccccctg
gagaggatcaaggtcctcatccatccccaggcctacgtccacggcctggtgcgcttcctg
gacggaagcctcaaggcccagctcggccccacggacatgcgccttttcatccagtacgcc
ctcacctaccccgagcgggcggagacccccctgaaggacctccccatccccggggtcctg
gaattcttagagcccgacctcaagcgctttcccgccctcgccgtggcctacgaggcggga
aggcgggggggcttggcccaggtggccgtctccgccgccgacgaggtggcggtggaggcc
ttcctccaggggaaaatccccttcccccgcatccccgagatcctggcccgggtgctggaa
gccacccccgcagagccgctaacatgggaaagcctcttcgccgtggacgcctgggcccgg
gaggaggccaagaggtgggcatga

DBGET integrated database retrieval system