KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0938Help
Entry
Ththe16_0938      CDS       T01867                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0938
   01230 Biosynthesis of amino acids
    Ththe16_0938
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0938
   00051 Fructose and mannose metabolism
    Ththe16_0938
   00562 Inositol phosphate metabolism
    Ththe16_0938
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ththe16_0938
Enzymes [BR:tts01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ththe16_0938
Exosome [BR:tts04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ththe16_0938
  Exosomal proteins of bladder cancer cells
   Ththe16_0938
  Exosomal proteins of melanoma cells
   Ththe16_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(895707..896459)
Genome map
AA seq 250 aa AA seqDB search
MRRVLVAGNWKMHKTPSEARVWFAELKRLLPPLQSEAAVLPAFPILPVAKEVLAETQVGY
GAQDVSAHKEGAYTGEVSARMLSDLGCRYAIVGHSERRRYHGETDALVAEKAKRLLEEGI
TPILCVGEPLEVREKGEAVPHTLRQLRGSLEGVEPPGPEALVIAYEPVWAIGTGKNATPE
DAEAMHQEIRKALAERYGEAFSSRVRILYGGSVNPKNFADLLSMPNVDGGLVGGASLELE
SFLALLRIAG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcggcgcgtcttggtggcgggcaactggaaaatgcacaaaacgccctccgaggccagg
gtgtggttcgccgagctcaagaggctccttccccctttgcagtcggaggccgccgtcctc
cccgccttccccatcctccccgtggccaaggaggtgttggccgaaacccaggtgggctac
ggggctcaggacgtctccgcccacaaggaaggggcctacacgggggaggtttcggcacgg
atgctttccgacctcggttgccgctacgccatcgtgggccactcggagcgaaggcgctac
cacggggaaacggacgccctggtggcggagaaggccaagaggcttctggaggaggggatc
acccccatcctctgcgtgggggaacccttggaggtgcgggaaaagggcgaggccgtgccc
cacaccttgaggcaactccgggggagcctcgagggggtggagccccctggccctgaggcc
ctcgtcatcgcctacgagcccgtgtgggccatcggcacgggcaaaaacgccacccctgag
gacgccgaggccatgcaccaggagatccgcaaggccctcgccgagcggtacggggaggcg
ttctcgagccgggttcgcatcctctacgggggaagcgtcaaccccaagaacttcgccgac
cttctttctatgcccaacgtggacggggggctcgtgggcggggcgagcctggagcttgaa
agcttcctcgccctcctccggatcgcgggttag

DBGET integrated database retrieval system