KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0985Help
Entry
Ththe16_0985      CDS       T01867                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Ththe16_0985
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0985
  Lipid metabolism
   00071 Fatty acid degradation
    Ththe16_0985
  Amino acid metabolism
   00350 Tyrosine metabolism
    Ththe16_0985
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Ththe16_0985
   00626 Naphthalene degradation
    Ththe16_0985
Enzymes [BR:tts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Ththe16_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
944363..945346
Genome map
AA seq 327 aa AA seqDB search
MTMRAMVLTEVGRPLVLRELPVPAPGPGEVLLRVEACAVCRTDLHIADGELPPPRLPLVL
GHQVVGRVVALGEGVEGRLGARVGVGWLASACGACKFCRRGEENLCPEARFTGYHRDGGY
AEYTLARAAFAYPLPEGDPVRLAPWMCAGLIGFRSYRFVRDRDPIGFYGFGAAAHLLAQV
ARYEGKRFYAFVRPGDEAAKAFAEALGAAWAGYSDEEPPEPLEGAIVFAPVGALVPKALK
DLEPGGVLVLGGIYMSPIPSMPYALLWLERQIRSVANLTREDARLFLEVAPKVPVVPEVE
RYPLEAANEALEALRQGRLRGSAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgcgggccatggtgctcaccgaggtggggcggcctctggtccttcgggagctc
cccgtgcccgcgccgggcccgggcgaagtcctcctgcgggtggaggcctgcgccgtctgc
cgcaccgacctccacatcgccgacggggagcttcccccgcccaggcttcccctggtcctg
ggccaccaggtggtgggccgggtggtggctttaggggagggggtagaggggcggcttggg
gcgcgggtgggggtagggtggctggcctcggcctgcggggcctgcaagttctgccggagg
ggagaggagaacctctgccccgaggcccgctttaccggctaccaccgggacggggggtat
gcggagtacaccctggcccgggccgccttcgcctaccctttgcccgagggggaccccgtg
cgcctcgccccttggatgtgtgccgggcttatcggcttccggagctaccgcttcgtgcgg
gaccgggaccccataggcttttacggcttcggggcggcggcccacctcctggcccaggtg
gcccgctacgaggggaagcgcttctacgccttcgtgcgccccggggacgaggcggccaag
gccttcgccgaggccttgggggcggcctgggcggggtattccgacgaggagcccccggag
cccttggagggggcgatcgtctttgccccggtgggggccctggtgcccaaggccctgaag
gacctcgagcccgggggggtgttggttctcggggggatctacatgagccccatcccctcc
atgccctacgccctcctttggctggagcgccagatccgctccgtggccaacctcacccgg
gaggacgcccggcttttcctggaggtggcccccaaggttcccgtggtgcccgaggtggag
cggtaccccctggaggcggcaaacgaggccctcgaggccctgcgccagggacggcttcgg
ggctcggcggtgctggttccttga

DBGET integrated database retrieval system