KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0998Help
Entry
Ththe16_0998      CDS       T01867                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_0998
   01230 Biosynthesis of amino acids
    Ththe16_0998
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0998
   00030 Pentose phosphate pathway
    Ththe16_0998
   00051 Fructose and mannose metabolism
    Ththe16_0998
  Energy metabolism
   00680 Methane metabolism
    Ththe16_0998
Enzymes [BR:tts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ththe16_0998
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ththe16_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(957272..958363)
Genome map
AA seq 363 aa AA seqDB search
MKVTLSVLKADIGSVGGHTLPSRKVLAKVEEVVREEVGRLLLDAYVFHIGDDIVLLLSHT
RGVRNQEVHALAWKAFREGTEVAKAEGLYGAGQDLLKDAFTGNLHGLGPQVAEMEFTERP
AEPFMVLAADKTEPGAFNLPLYLAFADPMYSSGLLLSPELRPGFRFRIMDLAQTERDSYI
ELDAPERLYDIATLLRDSHRFAIESIWSRKHGEQAAVVSTTRLRNIAGRYVGKDDPVAIV
RTQKIFPATEEFGPVFALAPYVAGDTRGSHHMPLMPVRANTPASTFFCVPMVCGLAFSLR
EGRLSEPVDLFADPVWEAVRAKVVEKAQEMRRQGFFGPAMLPMEELEYTGIAERLKALER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccttgagcgtgctcaaggcggacatcggctcggtgggcgggcacaccctg
cccagccgcaaggtcctcgccaaggtggaggaggtggtccgggaggaggtgggccgcctc
cttctggacgcctacgtcttccacatcggcgacgacatcgtcctcctcctatcccacacc
cggggggtgcggaaccaggaggtgcacgccctggcctggaaggccttccgtgagggcacc
gaggtggccaaggccgaaggcctctacggggcgggccaggacctccttaaggacgccttc
acggggaacctccacggcctcgggccccaggtggcggagatggagttcaccgagcgcccc
gcggagcccttcatggtcctcgccgccgacaagaccgagcccggggccttcaacctcccc
ctctacctggccttcgccgaccccatgtactcctcgggcctcctcctttccccggagctt
aggcccggcttccgcttccgcatcatggacctggcccagacggagcgggacagctacatt
gagctggacgcccccgagcgcctctacgacatcgccaccctccttcgcgactcccaccgc
ttcgccatagagtccatctggtcccggaagcacggggagcaggccgccgtggtgagcacc
acgcgcctgaggaacatcgccgggcgctacgtgggcaaggacgacccggtggccatcgtc
cgcacccagaagatcttccccgccacggaggagttcggccccgtcttcgccctcgcccct
tacgtggcgggggacacccggggaagccaccacatgcccctgatgcccgtgcgggccaac
accccggcctccaccttcttctgcgtgcccatggtctgcggcctggccttctccctgcgg
gaggggcggctttccgagcccgtggacctcttcgccgaccccgtgtgggaggcggtgcgg
gccaaggtggtggagaaggcccaggagatgcgccgccaggggttcttcggccccgccatg
cttcccatggaggagctggagtacacggggatcgccgagcggctgaaggctttggagcgg
gagttcagttaa

DBGET integrated database retrieval system