KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0998Help
Entry
Ththe16_0998      CDS       T01867                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00010  Glycolysis / Gluconeogenesis
tts00030  Pentose phosphate pathway
tts00051  Fructose and mannose metabolism
tts00680  Methane metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
tts01230  Biosynthesis of amino acids
Module
tts_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_0998
   00030 Pentose phosphate pathway
    Ththe16_0998
   00051 Fructose and mannose metabolism
    Ththe16_0998
  Energy metabolism
   00680 Methane metabolism
    Ththe16_0998
Enzymes [BR:tts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Ththe16_0998
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Ththe16_0998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: AEG33414
UniProt: F6DGQ6
Position
complement(957272..958363)
Genome map
AA seq 363 aa AA seqDB search
MKVTLSVLKADIGSVGGHTLPSRKVLAKVEEVVREEVGRLLLDAYVFHIGDDIVLLLSHT
RGVRNQEVHALAWKAFREGTEVAKAEGLYGAGQDLLKDAFTGNLHGLGPQVAEMEFTERP
AEPFMVLAADKTEPGAFNLPLYLAFADPMYSSGLLLSPELRPGFRFRIMDLAQTERDSYI
ELDAPERLYDIATLLRDSHRFAIESIWSRKHGEQAAVVSTTRLRNIAGRYVGKDDPVAIV
RTQKIFPATEEFGPVFALAPYVAGDTRGSHHMPLMPVRANTPASTFFCVPMVCGLAFSLR
EGRLSEPVDLFADPVWEAVRAKVVEKAQEMRRQGFFGPAMLPMEELEYTGIAERLKALER
EFS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcaccttgagcgtgctcaaggcggacatcggctcggtgggcgggcacaccctg
cccagccgcaaggtcctcgccaaggtggaggaggtggtccgggaggaggtgggccgcctc
cttctggacgcctacgtcttccacatcggcgacgacatcgtcctcctcctatcccacacc
cggggggtgcggaaccaggaggtgcacgccctggcctggaaggccttccgtgagggcacc
gaggtggccaaggccgaaggcctctacggggcgggccaggacctccttaaggacgccttc
acggggaacctccacggcctcgggccccaggtggcggagatggagttcaccgagcgcccc
gcggagcccttcatggtcctcgccgccgacaagaccgagcccggggccttcaacctcccc
ctctacctggccttcgccgaccccatgtactcctcgggcctcctcctttccccggagctt
aggcccggcttccgcttccgcatcatggacctggcccagacggagcgggacagctacatt
gagctggacgcccccgagcgcctctacgacatcgccaccctccttcgcgactcccaccgc
ttcgccatagagtccatctggtcccggaagcacggggagcaggccgccgtggtgagcacc
acgcgcctgaggaacatcgccgggcgctacgtgggcaaggacgacccggtggccatcgtc
cgcacccagaagatcttccccgccacggaggagttcggccccgtcttcgccctcgcccct
tacgtggcgggggacacccggggaagccaccacatgcccctgatgcccgtgcgggccaac
accccggcctccaccttcttctgcgtgcccatggtctgcggcctggccttctccctgcgg
gaggggcggctttccgagcccgtggacctcttcgccgaccccgtgtgggaggcggtgcgg
gccaaggtggtggagaaggcccaggagatgcgccgccaggggttcttcggccccgccatg
cttcccatggaggagctggagtacacggggatcgccgagcggctgaaggctttggagcgg
gagttcagttaa

DBGET integrated database retrieval system