KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1178Help
Entry
Ththe16_1178      CDS       T01867                                 

Definition
indole-3-glycerol-phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tts01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:tts00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133507..1134271
Genome map
AA seq 254 aa AA seqDB search
MRPDLARVPGVLGEIARRRALEVVPYPLPEPPPVPSFKEALLLPGLSLIAEVKKQSPSEG
LIREVDPVEAALAYQRGGARAVSVLTEPHRFGGSLLDLKRVREAVDLPLLRKDFVVDPFM
LEEARAFGASAALLIVALLGELTGAYLEEARRLGLEALVEVHTERELEIALEAGAEILGI
NNRDLATLKINLETAPRLGRLARKRGFGGVLVAESGYSRKGELKALEGLFDAVLIGTSLM
RAPDLEAALRELVG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgaccttgcccgcgtccctggagttttaggggagatcgccaggagaagggct
ttggaggtggtcccctatccccttcccgaacctccccccgtaccctccttcaaagaggcc
ctgcttctcccggggctttccctcatcgccgaggttaagaaacaaagcccctcggaaggg
ctcatccgggaggtggacccggtggaggccgccttggcctatcagcggggcggggcgagg
gcggtgagcgtcctcaccgagccccaccgcttcgggggaagccttctggacctcaagcgg
gtgcgggaggcggtggacctgcccctcctgaggaaggacttcgtggtggaccccttcatg
ctggaggaggcccgggcctttggggcgagcgccgcgcttctcatcgtggcccttttgggg
gagcttacgggggcctacctggaggaggcgagaaggcttggcctcgaggccctggtggag
gtccacacggagagggagctggagatcgccctcgaggccggcgcggagatcctcgggatc
aataaccgcgacctcgccaccctgaaaatcaacctggagaccgccccccgcctcggccgc
ctggcgcgaaagcggggcttcggcggggttttggtggcggagtcggggtattcccgaaag
ggggagctgaaagctctggaggggctttttgacgccgtcctcatcggcacgagcttgatg
cgggcgcccgatctggaggccgccttaagggagcttgtaggatag

DBGET integrated database retrieval system