KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1178Help
Entry
Ththe16_1178      CDS       T01867                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01130  Biosynthesis of antibiotics
tts01230  Biosynthesis of amino acids
Module
tts_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Ththe16_1178
Enzymes [BR:tts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Ththe16_1178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: AEG33585
UniProt: F6DH94
Structure
PDB: 

Jmol
Position
1133507..1134271
Genome map
AA seq 254 aa AA seqDB search
MRPDLARVPGVLGEIARRRALEVVPYPLPEPPPVPSFKEALLLPGLSLIAEVKKQSPSEG
LIREVDPVEAALAYQRGGARAVSVLTEPHRFGGSLLDLKRVREAVDLPLLRKDFVVDPFM
LEEARAFGASAALLIVALLGELTGAYLEEARRLGLEALVEVHTERELEIALEAGAEILGI
NNRDLATLKINLETAPRLGRLARKRGFGGVLVAESGYSRKGELKALEGLFDAVLIGTSLM
RAPDLEAALRELVG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccgaccttgcccgcgtccctggagttttaggggagatcgccaggagaagggct
ttggaggtggtcccctatccccttcccgaacctccccccgtaccctccttcaaagaggcc
ctgcttctcccggggctttccctcatcgccgaggttaagaaacaaagcccctcggaaggg
ctcatccgggaggtggacccggtggaggccgccttggcctatcagcggggcggggcgagg
gcggtgagcgtcctcaccgagccccaccgcttcgggggaagccttctggacctcaagcgg
gtgcgggaggcggtggacctgcccctcctgaggaaggacttcgtggtggaccccttcatg
ctggaggaggcccgggcctttggggcgagcgccgcgcttctcatcgtggcccttttgggg
gagcttacgggggcctacctggaggaggcgagaaggcttggcctcgaggccctggtggag
gtccacacggagagggagctggagatcgccctcgaggccggcgcggagatcctcgggatc
aataaccgcgacctcgccaccctgaaaatcaacctggagaccgccccccgcctcggccgc
ctggcgcgaaagcggggcttcggcggggttttggtggcggagtcggggtattcccgaaag
ggggagctgaaagctctggaggggctttttgacgccgtcctcatcggcacgagcttgatg
cgggcgcccgatctggaggccgccttaagggagcttgtaggatag

DBGET integrated database retrieval system