KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1275Help
Entry
Ththe16_1275      CDS       T01867                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Ththe16_1275
Enzymes [BR:tts01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Ththe16_1275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1226750..1228252)
Genome map
AA seq 500 aa AA seqDB search
MELPRAFGLLLHPTSLPGPYGVGVLGQEARDFLRFLKEAGGRYWQVLPLGPTGYGDSPYQ
SFSAFAGNPYLIDLRPLAERGYLRLEDPGFPQGRVDYGLLYAWKWPALKEAFRGFKEKAS
PEEREAFAAFREREAWWLEDYALFMALKAHHGGLPWNRWPLSLRKREEKALREAKSALAE
EVAFHAFTQWLFFRQWGALKAEAEALGIRIIGDMPIFVAEDSAEVWAHPEWFHLDEEGRP
TVVAGVPPDYFSETGQRWGNPLYRWDVLEREGFSFWIRRLEKALELFHLVRIDHFRGFEA
YWEIPASCPTAVEGRWVKAPGEKLFQKIQEVFGEVPVLAEDLGVITPEVEALRDRFGLPG
MKVLQFAFDDGMENPFLPHNYPAHGRVVVYTGTHDNDTTLGWYRTATPHEKAFMARYLAD
WGITFREEEEVPWALMHLGMKSVARLAVYPVQDVLALGSEARMNYPGRPSGNWAWRLLPG
GLSPEHGARLRAMAEATGRL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggagcttccccgcgctttcggcctgcttctccaccccacgagcctccccggcccctac
ggcgtcggcgtcctgggccaggaggcccgggacttcctccgcttcctcaaggaggcgggg
gggcggtactggcaggtcctccccttgggccccacgggctatggcgactccccctaccag
tccttcagcgccttcgccggaaacccctacctcatagacctgaggcccctcgcggagcgg
ggctacctgcgcctggaggaccccggcttcccccaaggccgggtggactacggcctcctt
tacgcctggaagtggcccgccctgaaggaggccttccggggcttcaaggaaaaggcctcc
ccggaggagcgggaggccttcgccgccttccgggagagggaggcctggtggctcgaggac
tacgccctcttcatggccctgaaggcccaccacggggggcttccctggaaccggtggccc
ctttccctgcggaagcgggaagagaaggcccttagggaggcgaaaagcgccttggccgag
gaggtggccttccacgccttcacccagtggctcttcttccgccagtggggggccttgaag
gcggaggccgaggcgttgggcatccggatcatcggggacatgcccatcttcgtggccgag
gactccgccgaggtctgggcccaccccgagtggtttcacctggacgaggagggccgcccc
acggtggtggcgggggtgccccccgactacttctcggagacggggcagcgctgggggaac
cccctttaccgctgggacgttttggagcgggaggggttctccttctggatccgccgtctg
gagaaggccctggagctcttccacctggtgcgcatagaccacttccggggctttgaggcc
tactgggagatccctgcaagctgccccacggcggtggaggggcgctgggtcaaggccccg
ggggagaagctcttccaaaagatccaggaggtttttggcgaggtccccgtccttgccgag
gacctgggggtgatcacccccgaggtggaggccttgcgggaccggttcggccttcccggg
atgaaggtcctgcagttcgcctttgacgacgggatggaaaaccccttcctcccccacaac
taccctgcccacggccgggtggtggtctacaccggcacccacgacaacgacaccaccttg
ggctggtaccgcaccgccaccccccacgagaaggccttcatggcgcggtacctggcggac
tgggggatcaccttccgggaagaggaggaggtgccctgggccctcatgcacctggggatg
aagtccgtggcccggcttgccgtctacccggtgcaggacgtcctggccctgggcagcgag
gcccggatgaactacccgggaaggccctcggggaactgggcctggcggctcctcccggga
gggctttccccggagcacggggcgaggcttagggccatggccgaggccacggggcggctt
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system