KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1297Help
Entry
Ththe16_1297      CDS       T01867                                 

Definition
(GenBank) Acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00010  Glycolysis / Gluconeogenesis
tts00620  Pyruvate metabolism
tts00640  Propanoate metabolism
tts00680  Methane metabolism
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_1297
   00620 Pyruvate metabolism
    Ththe16_1297
   00640 Propanoate metabolism
    Ththe16_1297
  Energy metabolism
   00680 Methane metabolism
    Ththe16_1297
Enzymes [BR:tts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Ththe16_1297
Lipid biosynthesis proteins [BR:tts01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Ththe16_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEG33700
UniProt: F6DHS9
Position
1248309..1250201
Genome map
AA seq 630 aa AA seqDB search
MEPVWYPDARAQETWLGRFMAELGFQDYEAFHRYSVEEAEAFYHAFFTRLGVPWRAPYTR
VVEGHFPFPRFFVGARLNLVEACLRHDPTRPALVHETEDGHVRSLTYGEARREVEKLAGG
LRALGVGRGDRVGLWLPMGLEAALALLAVAHLGGIAVPIFSGYGAEAAALRLKDAEAKLL
IVQDGFLRRGRRVELLPEARKARAMAGTEKVAVVRRLGLPLEEEVDLAALAGPSSPPEEM
ESMDPFMLIYTSGTTGRPKGTVHYHAGFPLKAALDLALLFDLREEDRLFWFTDLGWMMGP
WAILGGLILGATVFLYDGAPDHPGPDRLWRMVAAHRLTHLGLSPTLVRALIPFGEAPVEA
HDLSSLRVLGSTGEPWNLEPYLWFFRVVGKERLPIVNYSGGTEVSGGILGNVLVRPIKPM
GFNTAVPGMKAAVLDEEGRPVVGKVGELAVLAPWPGMTKGFWRDEARYLETYFQKVPGVW
VHGDFALLDEEGHFFLLGRSDDTLKVAGKRVGPAEVETAAMAHPALRECAAIGVPHPVKG
EAIVLFAVLKPGFAPSEALAEEVAERVAEALGKPLRPERVLFVPDLPKTRNAKVMRRVVR
AAYLDQDPGDLSALENPEAVVAIREAAQGG
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggtctggtaccctgacgcgcgcgcccaagagacctggcttggccgcttcatg
gccgagctcggcttccaggactacgaggccttccaccgctacagcgtggaggaggccgag
gccttctaccacgccttcttcacccggctcggcgtgccctggcgggccccgtacacccgg
gtggtggaaggccacttccccttcccccgcttcttcgtgggggcaaggctcaacctggtg
gaggcctgcctgcgccacgaccccacccggcccgccctcgtccacgagacggaggacggc
cacgtccggagcctcacctacggggaggcccgccgggaggtggaaaagctcgcagggggc
ctacgggccctgggggtggggcggggagaccgggtggggctatggcttcccatgggcctc
gaggcggccttggcccttctcgccgtggcccacctcggggggatcgccgtccccatcttc
tcgggctacggggcggaggccgccgccctccgcctcaaggacgccgaagctaagctcctc
atcgtccaagacggcttcctccgccggggacgccgggtggagctcctccccgaggcccgg
aaggccagggccatggcggggacggaaaaggtggccgtggtccgccgcctcggcctcccc
cttgaggaggaggtggacctcgccgccctcgccggcccctcctcgccgccggaggagatg
gagagcatggaccccttcatgctcatctacacctccgggaccacgggccgccccaagggc
acggttcactaccacgcgggcttccccctgaaggccgccctggacctcgccctcctcttt
gacctgagggaggaggaccgcctcttctggttcaccgacctcggctggatgatggggccc
tgggccatcctgggaggcctcatcctcggggccaccgtcttcctctacgacggggcgccg
gaccatccgggcccggaccgcctctggcgcatggtggcggcccaccgcctcacccactta
ggcctttcccccaccctggtgcgggccctcatcccctttggggaggcccccgtggaggcc
cacgacctctcctccctccgggtcctcggctccacgggagagccctggaacctcgagccc
tacctctggttcttccgggtggtgggcaaggagcggcttcccatcgtgaactactcgggg
ggcaccgaggtctcggggggcatcctggggaacgtcctggtgaggcccatcaagcccatg
gggttcaacaccgccgtgcccggcatgaaggccgcggtgctggacgaagaggggaggccc
gtggtgggcaaggtgggggagcttgccgtcctcgccccctggcccgggatgaccaagggc
ttctggcgggacgaggcccggtacctggagacctacttccagaaggtgcccggggtctgg
gtccacggggacttcgccctcctggacgaggaggggcacttcttcctcctcggccgctcc
gacgacaccctgaaggtggcgggaaagcgggtgggccccgccgaggtggagacggcagcc
atggcccatcccgccctgcgggagtgcgccgccatcggtgtgccccacccggtgaagggg
gaggccatcgtcctcttcgccgtgctgaagccgggcttcgccccctcggaggccctggcc
gaagaggtggcggaaagggtggccgaggccttagggaaacccctccgccccgagcgggtc
ctcttcgttcccgacctgcccaagacgcgcaacgccaaggtgatgcgccgggtggtccgg
gcagcctacttggaccaggaccccggggacctctccgccttggagaatccggaggcggtg
gtggccatccgggaagcggcccagggtggttag

DBGET integrated database retrieval system