KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1467Help
Entry
Ththe16_1467      CDS       T01867                                 

Definition
succinate dehydrogenase, membrane subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_1467
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ththe16_1467
   00650 Butanoate metabolism
    Ththe16_1467
  Energy metabolism
   00190 Oxidative phosphorylation
    Ththe16_1467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1410046..1410441)
Genome map
AA seq 131 aa AA seqDB search
MAIKSKRYQEARLEASTNLELYWWVFMRVSGVVLVFLLIGHMWMNAVLVDLNSIDYDYVA
KRLSQTTWKVYDWLILALALLHGGNGLRYVLDDWVRDPMKRFWTKVVVYSLLAFLFFLGS
LSLFNHDFGVN
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcgattaagtccaaaaggtaccaggaggcccggctcgaggccagcaccaacctggag
ctctactggtgggtcttcatgcgcgtctccggggtggtgctcgtcttcttgctcatcggc
cacatgtggatgaacgccgtcctcgtggacctcaactccattgactacgactacgtggct
aagagactttcccagaccacctggaaggtctacgactggctgatcctggccctggccctc
ctccacggggggaacgggctgcgctacgtgctggacgactgggtgcgggatcccatgaag
cgcttctggaccaaggtggtggtctacagccttttggcctttctcttcttcctggggagc
ctttccctctttaaccacgacttcggggtgaactag

DBGET integrated database retrieval system