KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1580Help
Entry
Ththe16_1580      CDS       T01867                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00230  Purine metabolism
tts01100  Metabolic pathways
Module
tts_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Ththe16_1580
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Ththe16_1580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_33 HEM4
Motif
Other DBs
NCBI-ProteinID: AEG33977
UniProt: F6DDX5
Position
complement(1514934..1515596)
Genome map
AA seq 220 aa AA seqDB search
MRGRLFVMTGASGVGKGTVRAKVLERTRLFYSISMTTRPPRPGEVDGVDYYFVDRPTFEA
LVREDGFLEYAEYVGHLYGTPRAPVERALSRGEDVLLEIEVQGALQVKRAVPEAVLIFLL
PPSLSELKRRLVYRGKDSPEKIQKRLEQAEWEIRNAHLFDYVVVNDVLEEAVADFLAILT
AERRRSGRMGEALEMALRRDLALEAELDEILRRRYGGTGH
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccgccttttcgtgatgaccggggcgagcggggtgggcaagggcacggtgcgg
gcgaaggtgctggagcgcacccggctcttctactccatctccatgaccacccgccccccc
cggccgggggaggtggacggggtggactactacttcgtggaccgccccacctttgaggcc
ctcgtccgcgaggacggcttcttggagtacgcggagtacgtgggccacctctacggcacc
cccagggccccggtggagcgggccttgagccggggggaggacgtcctcttggagattgag
gtccagggggcgctccaggtgaagcgggccgtgcccgaggcggtcctgatcttcctccta
cccccctctctctccgagctgaagcgccgcctggtctaccggggaaaggacagccccgag
aagatccagaagcgcctggagcaggcggagtgggagataaggaacgcccacctctttgac
tacgtggtggtgaacgacgtcctcgaggaggccgtggccgacttcctcgccatcctcacc
gcggagaggcggcggagcgggaggatgggggaggctttggagatggccctgcggcgcgat
ttggccctcgaggctgagctggacgagatcctaaggaggcggtatggcggaaccgggcat
tga

DBGET integrated database retrieval system