KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1620Help
Entry
Ththe16_1620      CDS       T01867                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tts03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552776..1553360
Genome map
AA seq 194 aa AA seqDB search
MRYPESLLKLTRALSRLPGIGPKTAQRLALHLAFHKEEAEALAEALEGLKRVRACRECGN
LAEGELCPICQDEDRDRSLLAVVESVADLYALERSGEFRGLYHVLGGALNPLEGIGPKEL
NLEGLFRRLEGVEEVVLATSMTVEGEATALYLAEELKKRGVRVTRPAYGLPVGGSLEYAD
EVTLGRALEGRRPV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcgctacccggaaagcctcctcaagctcacccgggccctctcccgcctccccggcatc
ggccccaagacggcccagcgcctggccctccacctcgccttccacaaggaggaggccgaa
gccctggcggaggccctggaggggctcaagcgggtccgggcctgccgcgagtgcggcaac
ctggccgagggggagctctgccccatctgccaggacgaggaccgggaccgctccctcctc
gccgtggtggagagcgtggccgacctgtacgccctggagcggagcggggagttccggggc
ctctaccacgtcctgggaggggccttgaaccccctggagggcatcggccccaaggagctg
aaccttgagggcctcttccggcggctggaaggcgtggaggaggtggtcctcgccacctcc
atgaccgtggagggggaggccaccgccctctacctcgccgaggagctgaagaagcggggg
gtgcgggtgacccggcccgcctacggcctccccgtgggggggagcctggagtacgccgac
gaggtgaccctgggccgggccctggaggggaggcggcccgtctag

DBGET integrated database retrieval system