KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1721Help
Entry
Ththe16_1721      CDS       T01867                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Brite
Enzymes [BR:tts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Ththe16_1721
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1630911..1631603
Genome map
AA seq 230 aa AA seqDB search
MHLLLLHGFTSHPVLTLGPLPERLKEAGWEVRQPALPGHGTRPEDLLKVRFQDWLLAAEE
AYLELPEPRGVVGLSMGGLLAAHLAARHPTKALVALAPAFALKNPLAPLAPYLHWLIPRF
PGPPSIEDPELRKRNPNYPYFPTRAVLELLALMRMTPEVLPRVKARALVVEAGKDRVVKG
VDRYFALLGSPRKDYLVFPESGHDLLLDRDREAVARAVRDWLIASDNYLQ
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcaccttctcctcctccacggcttcacctcccaccccgtcctcaccctcggccccctg
ccggaaaggctcaaggaggcggggtgggaggtgcgccagcccgccctgccgggccacggc
acgcggcccgaggacctcctaaaggtgcgctttcaggactggctcctggcggcggaggag
gcctacctggagcttcccgagccccggggggtggtggggctttccatgggggggcttctc
gccgcccacctcgccgcccgccaccccacaaaggccctcgtggccctggcccccgccttc
gccctgaaaaaccccttggcgcccttggcgccctacctccactggctcatcccccgcttt
cccggcccgccctccatagaggacccggagctcaggaagcgcaaccccaactacccctac
ttccccacccgggccgtcctggagctcctcgccctcatgcgcatgaccccggaagtcctc
ccccgggtgaaggcccgggccctggtggtggaggcggggaaagaccgggtggtgaagggg
gtggaccggtacttcgccctcctgggaagccccaggaaggactatctggtcttcccggaa
agcggccacgacctcctcctggaccgggaccgggaggcggtggcccgggcggtgcgcgac
tggcttattgcaagtgataactacttgcagtaa

DBGET integrated database retrieval system