KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1823Help
Entry
Ththe16_1823      CDS       T01867                                 

Definition
Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tts00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Ththe16_1823
Enzymes [BR:tts01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Ththe16_1823
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Ththe16_1823
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1718476..1719279
Genome map
AA seq 267 aa AA seqDB search
MPELPEVETTRRRLRPLVLGQTLRQVVHHDPARYRNTALAEGRRILEVDRRGKFLLFALE
GGVELVAHLGMTGGFRLEPTPHTRAALVLEDRTLYFHDPRRFGRLLGVRRGDYREIPLLL
RLGPEPLSEAFAFPGFFRGLKESARPLKALLLDQRLAAGVGNIYADEALFRARLSPFRPA
RSLTEEEARRLHRALREVLAEAVELGGSTLSDQSYRQPDGLPGGFQAHHAVYGRKGLPCP
ACGRPVERRVVAGRGTHFCPTCQGEGP
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcttcccgaggtggagaccacccgtaggcggctgcgtcccctggtcctgggc
cagacccttaggcaggtggtccaccacgaccccgcccgctaccggaacacggccctggcg
gaggggaggcggatcctggaagtggaccgccgggggaagttcctcctcttcgccctcgag
ggcggggtggagctcgtggcccacctggggatgacgggggggttccggctggagccgacg
ccccacacccgggcggccctggtcctcgaggaccggaccctctacttccacgacccccgg
cgcttcgggcgcctcttgggggtgcggcgcggggactaccgggagatccccctcctcctc
cgcctcggccccgagcccctctcggaggccttcgcctttcccgggttcttccgggggctg
aaggagagcgcgaggccccttaaggccctcctcctggaccagcgcctcgccgccggcgtg
ggcaacatctacgccgacgaggccctcttccgcgcccgcctaagccccttccgccccgcc
cgaagcctcaccgaggaggaggcgcggcgcctccaccgggccctgcgcgaggtgctggcg
gaggccgtggaactcgggggaagcaccctctcggaccaaagctaccgccagcccgacggc
ctccccgggggcttccaggcgcaccacgccgtctacggccgcaaaggcctcccctgcccg
gcctgcgggcgcccggtggagcggcgggtggtggccgggcggggcacccacttctgcccc
acctgccagggggaaggcccctag

DBGET integrated database retrieval system