KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1828Help
Entry
Ththe16_1828      CDS       T01867                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Ththe16_1828
Enzymes [BR:tts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Ththe16_1828
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1722990..1723592)
Genome map
AA seq 200 aa AA seqDB search
MRARLYAAFRQVGEDLFAQGLISATAGNFSVRTKGGFLITKSGVQKARLTPEDLLEVPLE
GPIPEGASVESVVHREIYRRTGARALVHAHPRVAVALSFHLPRLKPLDLEGQHYLKEVPV
LAPKTVSATEEAALSVAEALREHRACLLRGHGAFAVGLKEAPEEALLEAYGLMTTLEESA
QILLYHRLWQGAGPALGGGG
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgcccggttgtacgccgcgttccgtcaggtgggcgaggacctcttcgcccaaggg
ctcatctccgccacggccgggaacttctccgtgcgcaccaagggggggttcctcatcacc
aaaagcggggtgcagaaggcgaggctcaccccggaggaccttctggaggtgcccttggaa
gggcccatccccgaaggggcgagcgtggagagcgtggtccaccgggagatctaccgcagg
accggggcccgggccctggtccacgcccacccccgggtggccgtggccctctccttccac
cttccccgcctgaagcctttggacctcgagggccagcactacctgaaggaggtcccggtc
ctcgcccccaagacggtctccgccacggaggaggcggccttgagcgtggccgaggccttg
cgggagcaccgggcctgcctcctgagggggcacggggccttcgccgtgggcctgaaggag
gccccggaggaggccctcctcgaggcctacggcctcatgaccaccctggaggagagcgcc
cagatcctcctctaccaccgcctctggcagggggcggggcccgccttggggggtggggga
tga

DBGET integrated database retrieval system