KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1853Help
Entry
Ththe16_1853      CDS       T01867                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_1853
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Ththe16_1853
Enzymes [BR:tts01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Ththe16_1853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1752463..1753770
Genome map
AA seq 435 aa AA seqDB search
MEGLTPEMQREAEALRREWETNPRWKGVRRDYRPEDVVRLRPSVMVEYTLAKRGAEKLWK
LLHERPYVHTFGAYTGAMAVEMVRAGLEAIYLSGWQVAADANLAWQTYPDQSLYPYNSVP
QIVKRINNALMRADQVERIEGRVTRDWYVPIVADAEAGFGGALNVFELTKAMIEAGAAGI
HYEDQLASEKKCGHLGGKVLVPTGQHIRTLQAARLAADVMGVPTVIIARTDAEAATLITS
DIDERDKPFILPDERTPEGFYRFKNGIEAGIARALAYAPYADVIWMETSKPDLEEARKFA
EAVKKEFPDKLLAYNLSPSFNWKKFLDDETIAKFNRELGAMGYKFQFITLAGWHALNYHI
WELAKGYKERGMPAFVELQAKEFAAQKEGFTAVKHQREVGAGYFDEVVLALTQGQASTLA
LKGSTEEAQFNEPVH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggaagggctgacccccgagatgcaaagggaagcggaggcgctccgccgggagtgggag
acaaacccgaggtggaagggcgtccggcgggactaccgccccgaggacgtggtgcgctta
aggcccagcgtgatggtggagtacaccctggccaagcgaggggcggagaaactctggaag
ctcctccacgaaaggccctacgtgcacaccttcggggcctacaccggggccatggcggtg
gagatggtgcgggccgggctggaggccatctacctctccggctggcaggtggccgccgac
gccaacctggcctggcagacctaccccgaccagtccctctacccctacaactccgtgccc
cagatcgtgaagcgcatcaacaacgccctcatgcgggccgaccaggtggagcggattgaa
ggccgggtgacccgggactggtacgtgcctatcgtggccgacgccgaggcggggtttggc
ggggccctcaacgtctttgagctcaccaaagccatgatcgaggcaggggccgccgggatc
cactacgaggaccagctcgccagcgagaagaagtgcggccacctgggcggcaaggtcctg
gtgcccacgggccagcacatccgcaccctccaggcggccaggctcgccgcggacgtgatg
ggcgtgcccacggtgatcatcgcccgcaccgacgccgaggccgccaccctcatcaccagc
gacattgacgagcgggacaagcccttcatcctcccggacgagcgcacacccgagggcttc
taccgcttcaagaacgggattgaggccggcatcgcccgggccctggcctacgccccctac
gccgacgtgatctggatggaaacctccaagcccgacctggaggaggcccggaagttcgcc
gaggcggtgaagaaggagttccccgacaagctcctcgcctacaacctctccccctccttc
aactggaagaagttcctggacgacgagaccatcgccaagttcaaccgggagctcggggcg
atggggtacaagttccagttcatcaccctggcgggctggcacgccctgaactaccacatc
tgggagctggccaagggctacaaggagcggggcatgcccgccttcgtggagctccaggcg
aaggagttcgccgcccagaaggaaggcttcaccgccgtcaagcaccagcgggaggtgggg
gccgggtactttgacgaggtggtcctggccctgacccaggggcaggcctccaccctggcc
ctcaagggctccacggaagaggcccagttcaacgagcccgtccactga

DBGET integrated database retrieval system