KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_1960Help
Entry
Ththe16_1960      CDS       T01867                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ththe16_1960
   01230 Biosynthesis of amino acids
    Ththe16_1960
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ththe16_1960
   00030 Pentose phosphate pathway
    Ththe16_1960
   00051 Fructose and mannose metabolism
    Ththe16_1960
   00052 Galactose metabolism
    Ththe16_1960
  Energy metabolism
   00680 Methane metabolism
    Ththe16_1960
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Ththe16_1960
Protein phosphatases and associated proteins [BR:tts01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Ththe16_1960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1853310..1854278)
Genome map
AA seq 322 aa AA seqDB search
MKRIGVFTSGGDAPGMNAAIRAVVRQAHALGVEVIGIRRGYAGMIQGEMVPLGVRDVANI
IQRGGTILLTARSQEFLTKEGRAKAYAKLQAAGIEGLVAIGGDGTFRGALCLVEEHGMPV
VGVPGTIDNDLYGTDFTIGFDTAVNTALEAIDRIRDTAASHERVFFIEVMGRHAGFIALD
VGLAGGAEVIAVPEEPVDPKAVAEVLEASQRRGKKSSIVVVAEGAYPGGAEGLLAAIQEH
LQVEARVTVLGHIQRGGSPTAKDRILASRLGAAAVEALVGGASGVMVGEVEGEVDLTPLK
EAVERRKDINRALLRLSQVLAL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggggtgttcaccagcggcggcgatgcgccggggatgaacgcggccatc
cgggcggtggtgcgccaggcccacgcccttggggtggaggtcatcgggatccgccgcggc
tacgccggcatgatccaaggggagatggtgccccttggggtgcgggacgtggccaacatc
atccagcggggcgggacgatcctccttacggcgaggagccaagagttccttacgaaggag
gggcgggccaaggcctacgccaagctgcaggcggcggggattgagggcctggtggccatc
ggtggcgacgggaccttccgcggggcgctttgcctcgtggaggagcacgggatgccggtg
gtgggggtcccgggcaccatagacaacgacctctatggcacggacttcaccatcggcttt
gacaccgcggtgaacacggccctcgaggccatagaccgcatccgggacaccgcggcaagc
cacgagcgggtcttcttcatcgaggtcatggggcggcacgcggggttcatcgccctggac
gtggggcttgccggcggggcggaggtcatcgccgtccccgaggagcccgtggaccccaag
gccgtggccgaggtgctggaggcctcccagaggcgtgggaagaagagctccatcgtggta
gtggccgagggggcctaccccggcggggccgaggggcttctcgccgccatccaggagcac
ctccaggtggaggcccgggtcaccgtcctggggcacatccagcggggcgggagccccacg
gccaaggaccggatcctggcgagccgcctgggggcggccgcggtggaggccctggtgggc
ggggcgagcggggtcatggtgggggaggtggagggcgaggtggacctcacccccctgaag
gaagcggtggagcgcaggaaggacatcaaccgggccctcttgcgcctatcgcaggtgctg
gccctctag

DBGET integrated database retrieval system