KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_2174Help
Entry
Ththe16_2174      CDS       T01867                                 

Definition
acetylornithine deacetylase/succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Ththe16_2174
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ththe16_2174
Enzymes [BR:tts01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ththe16_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHTHE1601:198691..199848
Genome map
AA seq 385 aa AA seqDB search
MERALLAAEAVEEKEVVDLLRALVRIPSHYPGPGEEGVAAFLEAFLKERGLKPFRQEAAP
GRPNLVADLGEGEGGLLLEGHTDVVTPGDEALWRYPPYGGVVEGKRLYGRGACDMKGGLA
ALVGAMLAVKRALGKPPRPLRLAALADEEGMMLGVKAFVKAGLAQGFRGALVAEPEEMEV
CLFQKGALRLCLRFPGRMAHGAMPYAGENPIPKAARFVLEVQQVEKRLQERFPHPYLGPP
YLTPTRFLATAGEGQLNVIPAEAEVALDVRTTPGVDHAGLVAELAALAGAEVEVLEDRPP
VETPKEDPLVQAAEEALRLLGLPVRHGGVPGATDGTFLRAWAGLPVVVMGPGQKTLPHQV
DEWVDLEEVVQAARVYAALAVLYLG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtggagcgggccctgctcgcggcggaggcggtggaggagaaggaggtagtggacctcctt
agggccctggtgcggatcccgagccactacccggggcccggggaggagggggtggcggcc
ttcctcgaggccttcctcaaggagcggggccttaagcccttccgccaggaggcggccccc
gggcggcccaacctggtggcggacctgggggagggggaaggagggctcctcctggagggg
cacacggatgtggtcacccccggggacgaggccctctggcgctacccgccctacgggggg
gtggtggaagggaaaaggctctacggccggggggcctgcgacatgaagggaggcctcgcc
gccctggtgggggccatgcttgcggtgaagcgggccttggggaagcctccccgccccttg
cgcctcgccgccctggcggacgaggaggggatgatgctcggggtgaaggccttcgtgaag
gcgggcctcgcccagggcttccggggggccttggtggccgagcccgaggagatggaggtc
tgcctcttccagaagggggccctgcgcctttgcctccgcttcccgggcaggatggcccac
ggggccatgccctacgccggggagaaccccatccccaaggcggcccgcttcgtcctggag
gtccagcaggtggaaaagcgcctgcaggagcgcttcccccacccctacctggggcccccc
tacctcacccccacccgtttcctggccacggcgggagaaggccagctcaacgtcatcccc
gccgaagccgaggtggccctggacgtgcgcaccaccccgggggtggaccacgctggcctc
gtggcggagctcgccgccctcgccggggccgaggtggaggttctggaggaccgccccccc
gtggagaccccaaaggaggaccccctggtccaggcggcggaggaagccctacggctcctc
ggccttcccgtgaggcacgggggggtgcccggggccacggacggcaccttcctccgggcc
tgggcggggcttcccgtggtggtcatggggcccggccagaagaccctcccccaccaggtg
gacgaatgggtggacctggaagaggtggtccaagccgcccgggtctacgccgccctcgcg
gtcctctatctaggctag

DBGET integrated database retrieval system