KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_2186Help
Entry
Ththe16_2186      CDS       T01867                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tts00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHTHE1601:complement(218702..220192)
Genome map
AA seq 496 aa AA seqDB search
MRYLLALDQGTTSSRAILFTLEGRPLAVVQREFRQLYPKPGWVEHDPLEIWETTLWAAQE
ALRRAGVGAGEVLALGITNQRETTLVWDRKTGKPLHNAIVWQDRRTAPLCEALRARGLEP
LFRERTGLLFDPYFSGTKLLWLLENVPGLRARAERGEVCFGTVDTWLVWNLTGGKVFATD
PTNASRTLFFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVL
GDQQAALFGQGALGEGEGKCTYGTGAFLLLNTGERPVLSERGLLATVAWSLGRKATYALE
GSLFVAGAAVGWLKEVGLLQESREVEALAASVEDTGGVYFVPAFTGLGAPYWDPYARGTL
LGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQAD
LLGVPVVVPEVTETTALGAALMAGVGAGALSPEEVAGRYREAERFFPTMPEGRREALYRR
WREAVERAQGWAKEEG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacctgctcgctttggaccagggcaccacctcgagccgggccatcctcttcacc
ctagaggggaggccccttgcggtggtgcagcgggagttccggcagctttacccgaagccc
gggtgggtggagcacgaccccctggagatctgggagaccaccctttgggcggcgcaggag
gccttgcggcgggccggggtgggggcgggggaggtcctggccctggggatcacgaaccaa
cgggagacgaccctggtgtgggaccggaagacggggaagcccctccacaacgccatcgtc
tggcaggaccggcggacggcccccctgtgcgaggccttgagggcgcggggcctggagccc
cttttccgggagcgcaccgggctcctctttgacccctacttctcgggaacgaagcttttg
tggctcttggagaacgtgcccggtctgagggcgcgggcggaaaggggagaggtctgcttc
ggcaccgtggacacctggctcgtctggaacctcacggggggaaaggtcttcgccaccgac
cccaccaacgcgagccgcaccttgttcttcaacctccacaccctcgcctgggacccggag
ctcctcgaggccctcgggatccccgccgccctcctcccggaggtgcggccctcggacggg
gacttcggggaaaccctccccgagctcctgggggcgcccgtccccatccggggggtcttg
ggggaccagcaggcggccctcttcggccagggggccttaggggagggggaggggaagtgc
acctacggcaccggggccttcctcctcctgaacacgggggaaaggcccgtcctctcggaa
aggggccttctcgccacggtggcctggagccttgggaggaaggccacgtacgccctcgag
ggaagcctcttcgtggcgggggcggcggtgggctggctcaaggaggtcggcctcctacag
gaaagccgcgaggtggaggccctggcggcaagcgtggaggacacggggggcgtctacttc
gtccccgccttcaccggacttggcgccccctactgggacccctacgcccggggaaccctc
ctcggcctcacccgggggacgagccgggcccacctggcccgggcggccctggagggggtg
gccttccaggtgcgggacgtggttctggccatggaggaggaggccggggtccggctcaag
gtcctcaaggcggacgggggcatggcgcaaaaccgcctcttcctcaagatccaggcggac
ctcctcggggtgcccgtggtggtgccggaggtgacggagaccaccgccttgggggcggcc
ctcatggccggggtgggggcgggggccctttccccggaggaggtggcggggcgctaccgc
gaggcggaaaggtttttccccactatgcccgaggggaggcgggaagccctctaccggagg
tggcgggaggcggtggaaagggcccagggctgggcaaaggaggagggatga

DBGET integrated database retrieval system