KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_2186Help
Entry
Ththe16_2186      CDS       T01867                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Ththe16_2186
Enzymes [BR:tts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Ththe16_2186
Exosome [BR:tts04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ththe16_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHTHE1601:complement(218702..220192)
Genome map
AA seq 496 aa AA seqDB search
MRYLLALDQGTTSSRAILFTLEGRPLAVVQREFRQLYPKPGWVEHDPLEIWETTLWAAQE
ALRRAGVGAGEVLALGITNQRETTLVWDRKTGKPLHNAIVWQDRRTAPLCEALRARGLEP
LFRERTGLLFDPYFSGTKLLWLLENVPGLRARAERGEVCFGTVDTWLVWNLTGGKVFATD
PTNASRTLFFNLHTLAWDPELLEALGIPAALLPEVRPSDGDFGETLPELLGAPVPIRGVL
GDQQAALFGQGALGEGEGKCTYGTGAFLLLNTGERPVLSERGLLATVAWSLGRKATYALE
GSLFVAGAAVGWLKEVGLLQESREVEALAASVEDTGGVYFVPAFTGLGAPYWDPYARGTL
LGLTRGTSRAHLARAALEGVAFQVRDVVLAMEEEAGVRLKVLKADGGMAQNRLFLKIQAD
LLGVPVVVPEVTETTALGAALMAGVGAGALSPEEVAGRYREAERFFPTMPEGRREALYRR
WREAVERAQGWAKEEG
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaggtacctgctcgctttggaccagggcaccacctcgagccgggccatcctcttcacc
ctagaggggaggccccttgcggtggtgcagcgggagttccggcagctttacccgaagccc
gggtgggtggagcacgaccccctggagatctgggagaccaccctttgggcggcgcaggag
gccttgcggcgggccggggtgggggcgggggaggtcctggccctggggatcacgaaccaa
cgggagacgaccctggtgtgggaccggaagacggggaagcccctccacaacgccatcgtc
tggcaggaccggcggacggcccccctgtgcgaggccttgagggcgcggggcctggagccc
cttttccgggagcgcaccgggctcctctttgacccctacttctcgggaacgaagcttttg
tggctcttggagaacgtgcccggtctgagggcgcgggcggaaaggggagaggtctgcttc
ggcaccgtggacacctggctcgtctggaacctcacggggggaaaggtcttcgccaccgac
cccaccaacgcgagccgcaccttgttcttcaacctccacaccctcgcctgggacccggag
ctcctcgaggccctcgggatccccgccgccctcctcccggaggtgcggccctcggacggg
gacttcggggaaaccctccccgagctcctgggggcgcccgtccccatccggggggtcttg
ggggaccagcaggcggccctcttcggccagggggccttaggggagggggaggggaagtgc
acctacggcaccggggccttcctcctcctgaacacgggggaaaggcccgtcctctcggaa
aggggccttctcgccacggtggcctggagccttgggaggaaggccacgtacgccctcgag
ggaagcctcttcgtggcgggggcggcggtgggctggctcaaggaggtcggcctcctacag
gaaagccgcgaggtggaggccctggcggcaagcgtggaggacacggggggcgtctacttc
gtccccgccttcaccggacttggcgccccctactgggacccctacgcccggggaaccctc
ctcggcctcacccgggggacgagccgggcccacctggcccgggcggccctggagggggtg
gccttccaggtgcgggacgtggttctggccatggaggaggaggccggggtccggctcaag
gtcctcaaggcggacgggggcatggcgcaaaaccgcctcttcctcaagatccaggcggac
ctcctcggggtgcccgtggtggtgccggaggtgacggagaccaccgccttgggggcggcc
ctcatggccggggtgggggcgggggccctttccccggaggaggtggcggggcgctaccgc
gaggcggaaaggtttttccccactatgcccgaggggaggcgggaagccctctaccggagg
tggcgggaggcggtggaaagggcccagggctgggcaaaggaggagggatga

DBGET integrated database retrieval system