KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_2262Help
Entry
Ththe16_2262      CDS       T01867                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tts00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tts00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pTHTHE1601:283486..284916
Genome map
AA seq 476 aa AA seqDB search
MRLSLGELEVFLTAEGLEEAPGGVRLWGREVRVFPPFPAKGFFRHGWQSWSLAAWVDPAQ
APTPLLPEARRPQADDPFLLEAGAWWGSGVGALRGPDGRALLLGALDLGARVLGREDLLL
GRYAEKGGAWFLAYGPEEEVFAAYARLLPKRLSGRPPRVWCSWYSFYTRISEDLLLRVLD
EVAAFSFEVFQIDDGWQRALGDWEPNERFPRGMAFLAERIRERGLRAGLWFAPFLVTADS
PLFQKRPDWVLRDEEGRPVRAGFNWGRPLYALDAGNEEVVEWAADLVRKALAWGYDYLKL
DFLYAAALPGAEGEARYRKAMARLREAAGEAYLLFCGAPVLASLGLADGLRVGPDVAPYW
DNEERSFWLADPTGPGLRNALRSTLHRLWLMENVHVDPDVVYFRTRFNLLSPEEMRLQEA
LAHFTGFKATSDPPSWLLPEEKGRLEAFLAREVPVRRLGPYRFRVGEEEVDYAPLL
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgaggctaagcctaggggaactggaggttttcctcacggcggagggcctggaagaggcc
ccggggggagtgcgcctttggggcagggaggtgcgggtctttccccctttccccgccaag
gggttcttccgccacggctggcagagctggagcctcgccgcctgggtggaccccgctcag
gcccccacgcccctcctccccgaggcgcgccgcccccaggcggatgaccccttcctcctg
gaggccggggcgtggtggggaagcggcgtgggggcccttagggggccggacgggagggcg
ctccttctcggcgccctagaccttggggccagggtcctgggccgggaggacctcctgctt
ggccgctacgccgagaagggcggggcctggttcctcgcctacggcccggaagaggaggtc
tttgccgcctacgcccggcttctccccaagcgcctttccgggaggccccccagggtgtgg
tgctcctggtacagcttctacacgaggattagcgaggacctccttcttcgggttctggac
gaggtggcggccttctcctttgaggtcttccagatagacgacggctggcagcgggccctc
ggggactgggagcccaacgaacgcttcccccgggggatggccttcctcgcggagaggatc
cgggaaaggggcttaagggccgggctttggttcgcccccttcctggtcacggcggatagc
cccctcttccaaaagcgacccgactgggtgctgagggacgaggaggggaggcccgtgcgg
gcgggcttcaactggggcaggcccctctacgccctggacgcggggaacgaggaggtggtg
gagtgggctgcggacctcgtgcgtaaggccctcgcctggggctacgactacctgaagctg
gacttcctctacgccgccgccctcccgggggccgagggggaggcccgctaccggaaggcc
atggcccgcctgcgggaggcggcgggggaggcctacctcctcttctgcggggctcccgtc
ctcgcctccctgggcctcgccgacggcctccgggtaggccccgacgtggccccctactgg
gacaacgaggagcgctccttttggcttgcggaccccacggggccaggcctaaggaacgcc
ctccgctccaccctccaccgcctctggctcatggagaacgtccatgtggaccccgatgtg
gtctatttccgcacccgctttaacctgctttcccccgaggagatgcggcttcaggaggcc
ttggcccacttcaccggcttcaaggccacttccgacccgccctcgtggcttctcccggag
gagaaggggcgcctcgaggccttcctcgcccgggaggtcccggtgcggcgcctcggcccc
taccgctttagggtaggggaggaggaggtggactatgccccccttctataa

DBGET integrated database retrieval system