KEGG   Thielavia terrestris: THITE_112373Help
Entry
THITE_112373      CDS       T02228                                 

Definition
(RefSeq) histone acetyltransferase GCN5-like protein
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THITE_112373
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     THITE_112373
Chromosome [BR:ttt03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    THITE_112373
   HAT complexes
    PCAF complex
     THITE_112373
    STAGA complex
     THITE_112373
    TFTC complex
     THITE_112373
    SAGA complex
     THITE_112373
    SLIK complex
     THITE_112373
    ADA-HAT complex
     THITE_112373
    HAT-A2 complex
     THITE_112373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 GNAT_acetyltr_2
Motif
Other DBs
NCBI-GeneID: 11523434
NCBI-ProteinID: XP_003648907
JGI: Thite2_112373
UniProt: G2QRY4
Position
1:join(1558843..1559019,1559080..1560132)
Genome map
AA seq 409 aa AA seqDB search
MDKAEPQSLLADHGQAPRAVKRAASEEPNGTSDGKRIKTTSDVQPQATASSWRVPYPERP
AVVEERNGEIEFRVVNNDGERQSIIILTGLKCLFQKQLPKMPKDYIARLVYDRNHLSMAI
IKKPLEVIGGITYREFRHHKFAEIVFCAVSSDQQVKGYGAHLMAHLKDYVKATGPVMHFL
TYADNYATGYFQKQGFTKEITLDKSLWMGYIKDYEGGTLMQCSMLPRVRYLEAGRMLLKQ
KETVLAKIRAQSKSHIVHPPPQQWANGNVTPIDPLSIPAIQATGWSPDMDALARVPRHGP
HFNELRRFLYQIQNHKQAWPFLNPVNKDEVPDYYTVITSPMDLSTMEEKLERDLYATPRD
MIADLKLIFSNCRQYNDPSTVYAKCAAKLEKYMWTLIKEIPEWYDLLEE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcagagccgcaatcgcttttagccgaccacgggcaagctccccgtgccgtg
aagcgcgcagcttccgaagagcctaacggcacctctgatggcaaaaggatcaagaccaca
tcggatgtccaacctcaggccaccgccagctcgtggagggtcccttacccagaaaggcca
gcggttgtggaagaacggaatggcgagatcgaattccgagtggtcaacaacgatggtgag
agacagagcatcatcatccttacaggcctcaaatgcctgttccagaagcaactgccgaaa
atgcctaaagattacattgcacggcttgtctacgatcggaatcacctatcgatggccatc
atcaagaagcctctggaggtcattggcggaatcacctaccgagagttccgacaccacaag
ttcgctgaaatcgttttctgcgccgtctcctcggatcagcaggtcaaaggatacggtgcc
cacctgatggcccatttgaaggattacgtcaaagcgaccgggccggtgatgcactttctt
acctatgccgacaactatgcgactgggtatttccagaaacagggcttcaccaaagaaatc
accctcgacaagtccctctggatggggtatatcaaggactatgaaggaggcacgctgatg
cagtgctctatgcttcctcgagtccgctacctggaggccggccggatgcttcttaagcag
aaggaaaccgtgctcgccaagattcgggcccaaagcaaaagccacatcgtccatccaccg
ccccaacaatgggccaacggcaacgtcactccaatcgatccgctgtccatccctgccatt
caggcaaccggctggtctccggatatggatgcgctagcgcgggtgccgcgccacggacct
catttcaacgaactccggcgcttcctgtaccagatccagaaccacaagcaggcatggccg
ttcctcaatccggtcaacaaggacgaggtcccggattactacaccgtcattacctcgccc
atggatctgtcgaccatggaggagaaactggagcgcgatctctatgcgaccccgagagac
atgatcgccgatctcaagttgatcttcagcaattgccggcagtacaatgacccgtcaacg
gtatacgccaagtgtgctgccaagctggagaagtacatgtggaccctcatcaaggagatc
ccggagtggtacgacttgctcgaggaatga

DBGET integrated database retrieval system