KEGG   Thielavia terrestris: THITE_112373Help
Entry
THITE_112373      CDS       T02228                                 

Definition
histone acetyltransferase GCN5-like protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THITE_112373
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     THITE_112373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1558843..1559019,1559080..1560132)
Genome map
AA seq 409 aa AA seqDB search
MDKAEPQSLLADHGQAPRAVKRAASEEPNGTSDGKRIKTTSDVQPQATASSWRVPYPERP
AVVEERNGEIEFRVVNNDGERQSIIILTGLKCLFQKQLPKMPKDYIARLVYDRNHLSMAI
IKKPLEVIGGITYREFRHHKFAEIVFCAVSSDQQVKGYGAHLMAHLKDYVKATGPVMHFL
TYADNYATGYFQKQGFTKEITLDKSLWMGYIKDYEGGTLMQCSMLPRVRYLEAGRMLLKQ
KETVLAKIRAQSKSHIVHPPPQQWANGNVTPIDPLSIPAIQATGWSPDMDALARVPRHGP
HFNELRRFLYQIQNHKQAWPFLNPVNKDEVPDYYTVITSPMDLSTMEEKLERDLYATPRD
MIADLKLIFSNCRQYNDPSTVYAKCAAKLEKYMWTLIKEIPEWYDLLEE
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggacaaagcagagccgcaatcgcttttagccgaccacgggcaagctccccgtgccgtg
aagcgcgcagcttccgaagagcctaacggcacctctgatggcaaaaggatcaagaccaca
tcggatgtccaacctcaggccaccgccagctcgtggagggtcccttacccagaaaggcca
gcggttgtggaagaacggaatggcgagatcgaattccgagtggtcaacaacgatggtgag
agacagagcatcatcatccttacaggcctcaaatgcctgttccagaagcaactgccgaaa
atgcctaaagattacattgcacggcttgtctacgatcggaatcacctatcgatggccatc
atcaagaagcctctggaggtcattggcggaatcacctaccgagagttccgacaccacaag
ttcgctgaaatcgttttctgcgccgtctcctcggatcagcaggtcaaaggatacggtgcc
cacctgatggcccatttgaaggattacgtcaaagcgaccgggccggtgatgcactttctt
acctatgccgacaactatgcgactgggtatttccagaaacagggcttcaccaaagaaatc
accctcgacaagtccctctggatggggtatatcaaggactatgaaggaggcacgctgatg
cagtgctctatgcttcctcgagtccgctacctggaggccggccggatgcttcttaagcag
aaggaaaccgtgctcgccaagattcgggcccaaagcaaaagccacatcgtccatccaccg
ccccaacaatgggccaacggcaacgtcactccaatcgatccgctgtccatccctgccatt
caggcaaccggctggtctccggatatggatgcgctagcgcgggtgccgcgccacggacct
catttcaacgaactccggcgcttcctgtaccagatccagaaccacaagcaggcatggccg
ttcctcaatccggtcaacaaggacgaggtcccggattactacaccgtcattacctcgccc
atggatctgtcgaccatggaggagaaactggagcgcgatctctatgcgaccccgagagac
atgatcgccgatctcaagttgatcttcagcaattgccggcagtacaatgacccgtcaacg
gtatacgccaagtgtgctgccaagctggagaagtacatgtggaccctcatcaaggagatc
ccggagtggtacgacttgctcgaggaatga

DBGET integrated database retrieval system