KEGG   Thielavia terrestris: THITE_115243Help
Entry
THITE_115243      CDS       T02228                                 

Definition
histone acetyltransferase GCN5-like protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(857697..857709,857782..857906,857983..859032)
Genome map
AA seq 395 aa AA seqDB search
MKDENGKRKASDEPASPVASKRVKHDDSAEPEKPPAKIPAIPYPEKPAVIEERNGEIEFR
VVNNDGERESTIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITF
RPFKGRKFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYAIGYFKK
QGFTKEITLDKSVWMGYIKDYEGGTIMQCTMLPRIRYLEMGRMLLKQKECVQAKIRAFSK
SHIVHQPPKQWKNGVTPIDPLSIEAIRASGWSPDMDELARQPRHGPNYNQLLHLLNDLQN
HPSSWPFLVPVNKDEVLDYYDVIKEPMDLSTMESKLEADQYTTPEDFIRDAKLIFDNCRK
YNNENTPYAKSANKLEKFMWQQIRAIPEWSHLENS
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacgagaacgggaagcgcaaggcatccgatgagccggcgtcgcccgtcgcatcc
aagcgcgtcaaacacgacgactcggccgagcccgagaagccgcccgcaaagatcccagcg
attccgtatcctgaaaagcccgccgttatcgaggagcgcaatggcgagatcgaattccga
gtggtcaacaacgacggcgagcgcgaaagcaccatcatcctgacgggcctcaaatgcata
tttcagaaacagctccccaagatgcccaaggactacatcgcccggctcgtctacgaccgc
acccacctgtctatcgcgatcgtgaagaagccgcttgaggtcgtaggcggcatcacattc
cggcccttcaaagggcgcaaattcgccgagatcgtcttctgcgccatttcgtccgaccag
caggtcaagggctatggcgcccaccttatgtcccacctgaaagactacgtcaaggcgacg
tcggacgtgatgcacttcctcacctatgccgataactatgcgatcggctacttcaagaag
caagggttcacgaaggagataaccctcgacaagtccgtctggatggggtatatcaaagac
tacgaaggcggcacgatcatgcagtgcaccatgctgccgcgcatccgctacctggagatg
ggccggatgttgctcaagcagaaagagtgcgtccaggccaagatccgggccttctccaag
tcgcacattgtccatcagccaccgaagcagtggaagaacggcgtgacgccgatcgacccg
ctgtccatcgaggcgatccgcgcctcgggctggtcgccggacatggacgagctcgcgcgc
cagccgcggcacggacccaactacaaccagctgctgcacctgctcaacgacctgcagaac
cacccgtccagctggcccttcctggtaccggtcaacaaggacgaggtgctcgactactac
gacgtgatcaaggagccgatggacctgtccaccatggagagcaagctcgaggccgaccag
tacaccacgcccgaggacttcatccgcgacgccaagctcatcttcgacaactgccgcaag
tacaacaacgagaacacgccgtacgccaagtcggccaacaagctcgagaagttcatgtgg
cagcagatccgcgccatacccgagtggtcgcatctcgagaattcttag

DBGET integrated database retrieval system