KEGG   Thielavia terrestris: THITE_120962Help
Entry
THITE_120962      CDS       T02228                                 

Definition
glycoside hydrolase family 10 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     THITE_120962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(3757306..3757320,3757586..3758265,3758334..3758703))
Genome map
AA seq 354 aa AA seqDB search
MARLARALLMASGLLLAAGRPAAAQNQTQGEGLHSLMVAAGKLYFGTAMDTGNFNDPAYM
AIVTNKSEFGMFTPENSMKWQVTEPQLDKFSFTQADEVAQKVKSNGQMLRCHTLVWYSQL
PTFVANGSWTPATLSAVMTAHITNVVTHYAGQCYAWDVVNEALNEDGTFRQSVFFQTLGS
AFIPLAFRAAAAADPRAKLYYNDFNLETTPAKTAGALRIVQLLQSNKTRIDGVGFQAHLA
VNHTPPRTSLAATLRRFTALGLEVAYTELDVAQTALPESAAALAQQARDYVAVVGSCLDV
PRCVGVTVWQFTDKFSWVPAAFPGRGEACLFASDYSRKPAYDALVALLRGRRLR
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccagactagcccgggccctcttgatggcctcgggcctactcctggccgccggcagg
cccgcagccgcacagaaccagacccagggcgaaggcctgcactcgctgatggtggcagcc
ggcaagctgtacttcggcaccgccatggacacgggcaatttcaacgacccggcctacatg
gccatcgtaaccaacaagagcgagttcggcatgttcacgcccgaaaactcgatgaagtgg
caggtgaccgagcctcagctggacaagttctccttcacccaggcagacgaggtcgcccag
aaggtcaagtccaacggccagatgctgcgctgccacaccctggtctggtactcgcagctg
ccaaccttcgtcgccaacggcagctggaccccggccacgctcagcgccgtgatgacggcg
cacatcaccaacgtcgtgacgcactacgcggggcagtgctacgcgtgggacgtcgtcaac
gaggcgctcaacgaggacgggaccttccgacaatccgtcttcttccagacgctcggcagc
gccttcatcccgctggccttccgcgccgccgccgccgccgacccgcgcgccaagctgtac
tacaacgacttcaacctggagaccacacccgccaagacggccggcgcgctccgcatcgtc
cagctgctccagtccaacaaaacccgcatcgacggcgtcggcttccaggcccacctcgcc
gtcaaccacaccccgccgcgcaccagcctggccgccaccctgcgccggttcaccgccctc
ggcctcgaggtcgcatacacggagctggacgtggcgcagacggccctgccggagagcgcg
gccgcgctggcgcagcaggcgcgcgactacgtcgctgttgtcggatcgtgtctggacgtg
ccccggtgtgtgggcgtcaccgtctggcagttcactgacaagttcagctgggtgccggcc
gcgttcccgggacggggcgaggcgtgtctgtttgctagtgattatagccgcaagccggct
tatgatgcgcttgtggcgctgttgagggggaggcgtcttcgatga

DBGET integrated database retrieval system