KEGG   Thielavia terrestris: THITE_122396Help
Entry
THITE_122396      CDS       T02228                                 

Definition
histone acetyltransferase-like protein
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     THITE_122396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(4212126..4213539,4213640..4213725))
Genome map
AA seq 499 aa AA seqDB search
MGNNGANGEAEVGSDGPRQKGRATPDTLKVGCIALVLKDGQFRRAEILSIKETKSGRQFY
CNFDNFNKRLDEWVPISRIDFDQDVEWPNPEKDKQKDAKSKKTAPVSKKSQPSKKAQKKV
GKREQSVASEGQTPHPWTEFVESQTKPDGEDKANASLELGATPNVGPDEMELDEDETPAS
AAKKEHTQPFSREQEIEKLRTSGSMTQNPAEIARIRNISKVEFGRYVLFPWYFSPYPEAF
SQEDCIYICEFCLSYYADLTSFKRHRMKCTLLHPPGNEIYRDDFVSFFEIDGRRQRTWCR
NLCLLSKMFLDHKTLYYDVDPFLFYVMTSRDEKGSHIIGYFSKEKESADGYNVACILTLP
QYQRKGYGRLLIQFSYELSKIEGKLGSPEKPLSDLGLLSYRQYWSENIIDLLLGYSEREE
KCTIEGIASHLAMTTQDVEHTLQALKMQVYHKGEHKIVIPEKLVQQREKSRAKQRRVIDP
SRIQWKPPVFTAASRTWGW
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgggcaataacggcgctaatggcgaggccgaggtaggctccgatgggccaaggcaaaag
ggccgggcgacgcccgacacgctcaaagtcgggtgcatagccctcgtcctgaaagacgga
caattccggcgtgccgaaatcctcagcatcaaggaaaccaagagcgggaggcagttctac
tgcaattttgataacttcaacaagcggttggacgaatgggtcccgatctcgaggatcgac
ttcgaccaggacgtcgagtggccgaacccggagaaggacaagcagaaggacgctaagagc
aagaagacggcgccggtgtctaagaagtcgcagccgtctaagaaggcgcagaagaaggtc
ggcaagcgggagcagtcggtcgcgtcagagggccagacgccgcacccctggaccgagttt
gtcgagtcgcaaaccaagccagatggcgaagacaaggcaaatgcgagcctggagcttggc
gccacgcccaatgtcggccccgacgagatggaactggacgaggacgagacgccggccagc
gcggccaagaaggagcatacccagccgttcagccgagagcaggagatagagaagctgcgg
acgtcgggctctatgacgcagaacccagccgagatcgcccgcatccggaacatctccaag
gtggagtttgggcggtacgtgcttttcccgtggtacttttctccatacccggaggccttc
agccaggaggactgcatctacatctgcgagttctgcctcagctactacgccgacctcacg
tcattcaaacggcaccgcatgaagtgcacgctgctgcaccctcccgggaacgaaatctac
cgggacgatttcgtgtcgttcttcgagatcgacggcaggcggcagcggacgtggtgccgg
aacctgtgtctgctctccaaaatgttcctcgatcacaagacgctctactacgatgtggac
ccgttcctcttctacgtcatgacgtcgcgggacgaaaaggggtcgcatatcatcggctac
ttctccaaggagaaggagagcgcggacggctacaacgtggcgtgcatcctcacgctgccg
cagtaccagcggaaggggtacggccgattgctcatccagttctcgtacgagctgtccaag
atcgagggcaagctggggtcgccggagaagccgctctcggacctgggactgctgagctac
cggcaatactggtccgagaacatcatcgacctgctgcttgggtacagcgagcgcgaggag
aagtgcacgattgaagggatcgcgtcacacctcgccatgacaacccaagacgtcgagcac
acgctgcaggctctgaagatgcaggtctaccacaagggcgagcacaagattgtgattccg
gagaagctggtgcagcagcgcgagaagtcaagggccaagcagaggcgcgtcattgatcct
tcccggatccagtggaaaccacccgtctttacggcggcgagcaggacatggggatggtag

DBGET integrated database retrieval system