KEGG   Thielavia terrestris: THITE_124883Help
Entry
THITE_124883      CDS       T02228                                 

Definition
glycoside hydrolase family 5 protein (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ttt  Thielavia terrestris
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_124883
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     THITE_124883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(4604419..4604634,4604706..4604752,4604832..4604898,4604965..4605022,4605098..4605339,4605454..4605788,4605989..4606049)
Genome map
AA seq 341 aa AA seqDB search
MKLCNIVLGAAAAASALAAPAADVPTPTAKTGKRSSKFKFVGANESGAEFGNKALPGQLG
KDYTWPVRSSIDTLMSKGMNTFRIPIMMERLIPTKLTGSINETYAQGLTDIVSYITGKGA
YAVVDPHNFGRYYNNIISDVDGFKAWWATTAKLFASNDKVIFDTNNEYHDMDNSLVARLN
QAAIDGIRGAGATSQYIFVEGNSWTGAWTWTSSGNGQSLASLTDPQDKLVYEMHQYLDSD
GSGTSETCVSATIGQERIRDATAWLKAQGKKGVLGETAGGANAQCIAALTGMLGDMASNS
DVWLGWLWWGAGPWWGSYIYGMEPPSGVAYQKVLPSLQAYI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttgcaatatcgttcttggcgctgctgcggccgcctcggcgctcgcagctcca
gctgccgatgtcccaaccccgactgcaaagacgggcaagcgctccagcaagttcaagttc
gtcggcgccaacgagtctggagctgagttcggcaacaaggcgcttccaggccaacttggc
aaggactacacctggccggtcaggtccagcattgacacgctcatgagcaaaggaatgaac
accttccgaattcccattatgatggagcgtctcatccccaccaagttgactggcagcatc
aacgagacgtacgcccaagggctgactgatatcgtctcatacatcaccggcaaaggggcc
tacgccgtcgtcgaccctcacaacttcggccggtattacaacaacatcattagcgacgtc
gacggcttcaaggcctggtgggcgacgacggccaagctgttcgccagcaacgacaaggtc
atcttcgacaccaacaacgagtaccacgacatggacaactcgctggtggcgcggctcaac
caggcggccatcgacggcatccgcggggcgggcgcgacgtcgcagtacatttttgtcgag
ggcaactcctggaccggcgcatggacttggacctcctccggcaacggccagagcctggcg
agcctgacggacccgcaggacaagctggtgtacgagatgcaccagtacctggactcggac
gggtcgggcacgtccgagacgtgcgtgtcggcgacgatcgggcaggagcgcatccgcgac
gcgaccgcctggctcaaggcgcagggcaagaagggcgtgctgggcgagacggcgggcggc
gccaacgcgcagtgcatcgccgcgctgaccggcatgctgggcgacatggccagcaactcg
gacgtctggctgggctggctctggtggggtgctgggccctggtgggggtcgtatatctat
gggatggaaccgccgagtggtgttgcgtatcagaaagtgttgccgagtctgcaggcgtac
atctga

DBGET integrated database retrieval system